LEPROTL1 (NM_015344) Human Mass Spec Standard
CAT#: PH300535
LEPROTL1 MS Standard C13 and N15-labeled recombinant protein (NP_056159)
View other "LEPROTL1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | LEPROTL1 MS Standard C13 and N15-labeled recombinant protein (NP_056159) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200535 |
| Predicted MW | 14.4 kDa |
| Protein Sequence |
>RC200535 protein sequence
Red=Cloning site Green=Tags(s) MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELA IFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056159 |
| RefSeq Size | 2721 |
| RefSeq ORF | 393 |
| Synonyms | HSPC112; my047; Vps55 |
| Locus ID | 23484 |
| Cytogenetics | 8p12 |
| Summary | Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402424 | LEPROTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402424 | Transient overexpression lysate of leptin receptor overlapping transcript-like 1 (LEPROTL1), transcript variant 1 |
CNY 3080.00 |
|
| TP300535 | Purified recombinant protein of Homo sapiens leptin receptor overlapping transcript-like 1 (LEPROTL1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它LEPROTL1产品
