DUSP14 (NM_007026) Human Mass Spec Standard
CAT#: PH300531
DUSP14 MS Standard C13 and N15-labeled recombinant protein (NP_008957)
View other "DUSP14" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DUSP14 MS Standard C13 and N15-labeled recombinant protein (NP_008957) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200531 |
Predicted MW | 22.3 kDa |
Protein Sequence |
>RC200531 protein sequence
Red=Cloning site Green=Tags(s) MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQ FEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW VKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_008957 |
RefSeq Size | 1508 |
RefSeq ORF | 594 |
Synonyms | MKP-L; MKP6 |
Locus ID | 11072 |
Cytogenetics | 17q12 |
Summary | Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402077 | DUSP14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402077 | Transient overexpression lysate of dual specificity phosphatase 14 (DUSP14) |
CNY 3080.00 |
|
TP300531 | Recombinant protein of human dual specificity phosphatase 14 (DUSP14), 20 µg |
CNY 2900.00 |