Adenylosuccinate Lyase (ADSL) (NM_000026) Human Mass Spec Standard
CAT#: PH300524
ADSL MS Standard C13 and N15-labeled recombinant protein (NP_000017)
View other "Adenylosuccinate Lyase" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ADSL MS Standard C13 and N15-labeled recombinant protein (NP_000017) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200524 |
| Predicted MW | 54.9 kDa |
| Protein Sequence |
>RC200524 protein sequence
Red=Cloning site Green=Tags(s) MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLE NIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVIS RLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQ LFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEE PFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADT ILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGD NDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000017 |
| RefSeq Size | 1565 |
| RefSeq ORF | 1452 |
| Synonyms | AMPS; ASASE; ASL |
| Locus ID | 158 |
| Cytogenetics | 22q13.1 |
| Summary | The protein encoded by this gene belongs to the lyase 1 family. It is an essential enzyme involved in purine metabolism, and catalyzes two non-sequential reactions in the de novo purine biosynthetic pathway: the conversion of succinylaminoimidazole carboxamide ribotide (SAICAR) to aminoimidazole carboxamide ribotide (AICAR) and the conversion of adenylosuccinate (S-AMP) to adenosine monophosphate (AMP). Mutations in this gene are associated with adenylosuccinase deficiency (ADSLD), a disorder marked with psychomotor retardation, epilepsy or autistic features. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424970 | ADSL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426615 | ADSL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424970 | Transient overexpression lysate of adenylosuccinate lyase (ADSL), transcript variant 1 |
CNY 3080.00 |
|
| LY426615 | Transient overexpression lysate of adenylosuccinate lyase (ADSL), transcript variant 2 |
CNY 3080.00 |
|
| TP300524 | Recombinant protein of human adenylosuccinate lyase (ADSL), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Adenylosuccinate Lyase产品


