Dynein light chain (DNAL4) (NM_005740) Human Mass Spec Standard
CAT#: PH300520
DNAL4 MS Standard C13 and N15-labeled recombinant protein (NP_005731)
View other "Dynein light chain" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DNAL4 MS Standard C13 and N15-labeled recombinant protein (NP_005731) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200520 |
Predicted MW | 12 kDa |
Protein Sequence |
>RC200520 protein sequence
Red=Cloning site Green=Tags(s) MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005731 |
RefSeq Size | 1504 |
RefSeq ORF | 315 |
Synonyms | MRMV3; PIG27 |
Locus ID | 10126 |
Cytogenetics | 22q13.1 |
Summary | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. [provided by RefSeq, Dec 2014] |
Protein Pathways | Huntington's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417100 | DNAL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417100 | Transient overexpression lysate of dynein, axonemal, light chain 4 (DNAL4) |
CNY 3080.00 |
|
TP300520 | Recombinant protein of human dynein, axonemal, light chain 4 (DNAL4), 20 µg |
CNY 2900.00 |
其它Dynein light chain产品