Dynein light chain (DNAL4) (NM_005740) Human Mass Spec Standard
CAT#: PH300520
DNAL4 MS Standard C13 and N15-labeled recombinant protein (NP_005731)
View other "Dynein light chain" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DNAL4 MS Standard C13 and N15-labeled recombinant protein (NP_005731) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200520 |
| Predicted MW | 12 kDa |
| Protein Sequence |
>RC200520 protein sequence
Red=Cloning site Green=Tags(s) MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWH VVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005731 |
| RefSeq Size | 1504 |
| RefSeq ORF | 315 |
| Synonyms | MRMV3; PIG27 |
| Locus ID | 10126 |
| Cytogenetics | 22q13.1 |
| Summary | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. [provided by RefSeq, Dec 2014] |
| Protein Pathways | Huntington's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417100 | DNAL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417100 | Transient overexpression lysate of dynein, axonemal, light chain 4 (DNAL4) |
CNY 3080.00 |
|
| TP300520 | Recombinant protein of human dynein, axonemal, light chain 4 (DNAL4), 20 µg |
CNY 2900.00 |
其它Dynein light chain产品
