GCDH (NM_000159) Human Mass Spec Standard
CAT#: PH300473
GCDH MS Standard C13 and N15-labeled recombinant protein (NP_000150)
View other "GCDH" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GCDH MS Standard C13 and N15-labeled recombinant protein (NP_000150) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200473 |
Predicted MW | 48.1 kDa |
Protein Sequence |
>RC200473 protein sequence
Red=Cloning site Green=Tags(s) MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDWQDPLVLEEQLTTDEILIRDT FRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSA MSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTK TWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGA SSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHAC LQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIH ALILGRAITGIQAFTASK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000150 |
RefSeq Size | 1897 |
RefSeq ORF | 1314 |
Synonyms | ACAD5; GCD |
Locus ID | 2639 |
Cytogenetics | 19p13.13 |
Summary | The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45-kD subunits. Mutations in this gene result in the metabolic disorder glutaric aciduria type 1, which is also known as glutaric acidemia type I. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 12. [provided by RefSeq, Mar 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Fatty acid metabolism, Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415563 | GCDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC424891 | GCDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429397 | GCDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415563 | Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 4840.00 |
|
LY424891 | Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
LY429397 | Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
TP300473 | Recombinant protein of human glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720971 | Purified recombinant protein of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 1800.00 |