GSK3 beta (GSK3B) (NM_002093) Human Mass Spec Standard
CAT#: PH300468
GSK3B MS Standard C13 and N15-labeled recombinant protein (NP_002084)
View other "GSK3 beta" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GSK3B MS Standard C13 and N15-labeled recombinant protein (NP_002084) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200468 |
| Predicted MW | 47.9 kDa |
| Protein Sequence |
>RC200468 representing NM_002093
Red=Cloning site Green=Tags(s) MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ IREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAH SFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ TNNAASASASNST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002084 |
| RefSeq Size | 1639 |
| RefSeq ORF | 1299 |
| Locus ID | 2932 |
| Cytogenetics | 3q13.33 |
| Summary | The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Alzheimer's disease, Axon guidance, Basal cell carcinoma, B cell receptor signaling pathway, Cell cycle, Chemokine signaling pathway, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Hedgehog signaling pathway, Insulin signaling pathway, Melanogenesis, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, T cell receptor signaling pathway, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419542 | GSK3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431916 | GSK3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419542 | Transient overexpression lysate of glycogen synthase kinase 3 beta (GSK3B), transcript variant 1 |
CNY 3080.00 |
|
| LY431916 | Transient overexpression lysate of glycogen synthase kinase 3 beta (GSK3B), transcript variant 2 |
CNY 3080.00 |
|
| TP300468 | Recombinant protein of human glycogen synthase kinase 3 beta (GSK3B), 20 µg |
CNY 2900.00 |
|
| TP710339 | Purified recombinant protein of Human glycogen synthase kinase 3 beta (GSK3B), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
其它GSK3 beta产品


