HPRT (HPRT1) (NM_000194) Human Mass Spec Standard
CAT#: PH300462
HPRT1 MS Standard C13 and N15-labeled recombinant protein (NP_000185)
View other "HPRT" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HPRT1 MS Standard C13 and N15-labeled recombinant protein (NP_000185) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200462 |
| Predicted MW | 24.6 kDa |
| Protein Sequence |
>RC200462 protein sequence
Red=Cloning site Green=Tags(s) MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKG GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTG KTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISE TGKAKYKA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000185 |
| RefSeq Size | 1435 |
| RefSeq ORF | 654 |
| Synonyms | HGPRT; HPRT |
| Locus ID | 3251 |
| Cytogenetics | Xq26.2-q26.3 |
| Summary | The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.[provided by RefSeq, Jun 2009] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400070 | HPRT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400070 | Transient overexpression lysate of hypoxanthine phosphoribosyltransferase 1 (HPRT1) |
CNY 3080.00 |
|
| TP300462 | Recombinant protein of human hypoxanthine phosphoribosyltransferase 1 (HPRT1), 20 µg |
CNY 2900.00 |
|
| TP720264 | Recombinant protein of human hypoxanthine phosphoribosyltransferase 1 (HPRT1) |
CNY 1800.00 |
