RAB6A (NM_002869) Human Mass Spec Standard
CAT#: PH300432
RAB6A MS Standard C13 and N15-labeled recombinant protein (NP_002860)
View other "RAB6A" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RAB6A MS Standard C13 and N15-labeled recombinant protein (NP_002860) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200432 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC200432 protein sequence
Red=Cloning site Green=Tags(s) MSTGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTA GQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEE GERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002860 |
RefSeq Size | 3419 |
RefSeq ORF | 624 |
Synonyms | RAB6 |
Locus ID | 5870 |
Cytogenetics | 11q13.4 |
Summary | This gene encodes a member of the RAB family, which belongs to the small GTPase superfamily. GTPases of the RAB family bind to various effectors to regulate the targeting and fusion of transport carriers to acceptor compartments. This protein is located at the Golgi apparatus, which regulates trafficking in both a retrograde (from early endosomes and Golgi to the endoplasmic reticulum) and an anterograde (from the Golgi to the plasma membrane) directions. Myosin II is an effector of this protein in these processes. This protein is also involved in assembly of human cytomegalovirus (HCMV) by interacting with the cellular protein Bicaudal D1, which interacts with the HCMV virion tegument protein, pp150. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404772 | RAB6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419062 | RAB6A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404772 | Transient overexpression lysate of RAB6A, member RAS oncogene family (RAB6A), transcript variant 2 |
CNY 3080.00 |
|
LY419062 | Transient overexpression lysate of RAB6A, member RAS oncogene family (RAB6A), transcript variant 1 |
CNY 3080.00 |
|
PH310594 | RAB6A MS Standard C13 and N15-labeled recombinant protein (NP_942599) |
CNY 19520.00 |
|
TP300432 | Recombinant protein of human RAB6A, member RAS oncogene family (RAB6A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP310594 | Recombinant protein of human RAB6A, member RAS oncogene family (RAB6A), transcript variant 2, 20 µg |
CNY 2900.00 |