AK6 (NM_016283) Human Mass Spec Standard
CAT#: PH300412
TAF9 MS Standard C13 and N15-labeled recombinant protein (NP_057367)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TAF9 MS Standard C13 and N15-labeled recombinant protein (NP_057367) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200412 |
| Predicted MW | 20.1 kDa |
| Protein Sequence |
>RC200412 protein sequence
Red=Cloning site Green=Tags(s) MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMR EGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEI VHQLPSNKPEELENNVDQILKWIEQWIKDHNS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057367 |
| RefSeq Size | 962 |
| RefSeq ORF | 516 |
| Synonyms | AD-004; CGI-137; CINAP; CIP; hCINAP |
| Locus ID | 102157402 |
| Cytogenetics | 5q13.2 |
| Summary | This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402534 | AK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423136 | AK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425392 | AK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402534 | Transient overexpression lysate of TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2 |
CNY 3080.00 |
|
| LY423136 | Transient overexpression lysate of TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 3 |
CNY 3080.00 |
|
| TP300412 | Recombinant protein of human TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa (TAF9), transcript variant 2, 20 µg |
CNY 2900.00 |
