Uridine Phosphorylase 1 (UPP1) (NM_003364) Human Mass Spec Standard
CAT#: PH300406
UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_003355)
View other "Uridine Phosphorylase 1" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_003355) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200406 |
| Predicted MW | 33.9 kDa |
| Protein Sequence |
>RC200406 protein sequence
Red=Cloning site Green=Tags(s) MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003355 |
| RefSeq Size | 1733 |
| RefSeq ORF | 930 |
| Synonyms | UDRPASE; UP; UPASE; UPP |
| Locus ID | 7378 |
| Cytogenetics | 7p12.3 |
| Summary | This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016] |
| Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405710 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418738 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429141 | UPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405710 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 2 |
CNY 3080.00 |
|
| LY418738 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 3080.00 |
|
| LY429141 | Transient overexpression lysate of uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 3080.00 |
|
| PH319125 | UPP1 MS Standard C13 and N15-labeled recombinant protein (NP_853628) |
CNY 19520.00 |
|
| TP300406 | Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP319125 | Recombinant protein of human uridine phosphorylase 1 (UPP1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720926 | Purified recombinant protein of Human uridine phosphorylase 1 (UPP1), transcript variant 1 |
CNY 1800.00 |
其它Uridine Phosphorylase 1产品
