Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Mass Spec Standard
CAT#: PH300374
COX6C MS Standard C13 and N15-labeled recombinant protein (NP_004365)
View other "Cytochrome C Oxidase subunit VIc" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | COX6C MS Standard C13 and N15-labeled recombinant protein (NP_004365) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200374 |
| Predicted MW | 8.8 kDa |
| Protein Sequence |
>RC200374 protein sequence
Red=Cloning site Green=Tags(s) MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI FQSVK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004365 |
| RefSeq Size | 921 |
| RefSeq ORF | 225 |
| Locus ID | 1345 |
| Cytogenetics | 8q22.2 |
| Summary | Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12. [provided by RefSeq, Jul 2010] |
| Protein Families | Transmembrane |
| Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418028 | COX6C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418028 | Transient overexpression lysate of cytochrome c oxidase subunit VIc (COX6C) |
CNY 3080.00 |
|
| TP300374 | Recombinant protein of human cytochrome c oxidase subunit VIc (COX6C), 20 µg |
CNY 2900.00 |
其它Cytochrome C Oxidase subunit VIc产品
