elF2 alpha (EIF2S1) (NM_004094) Human Mass Spec Standard
CAT#: PH300368
EIF2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004085)
View other "elF2 alpha" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | EIF2S1 MS Standard C13 and N15-labeled recombinant protein (NP_004085) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200368 |
| Predicted MW | 36.1 kDa |
| Protein Sequence |
>RC200368 protein sequence
Red=Cloning site Green=Tags(s) MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNEC VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDD KYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKE ALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTD TDETELARQMERLERENAEVDGDDDAEEMEAKAED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004085 |
| RefSeq Size | 4165 |
| RefSeq ORF | 945 |
| Synonyms | EIF-2; EIF-2A; EIF-2alpha; EIF2; EIF2A |
| Locus ID | 1965 |
| Cytogenetics | 14q23.3 |
| Summary | The translation initiation factor EIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, EIF2, and GTP. EIF2 is composed of 3 nonidentical subunits, the 36-kD EIF2-alpha subunit (EIF2S1), the 38-kD EIF2-beta subunit (EIF2S2; MIM 603908), and the 52-kD EIF2-gamma subunit (EIF2S3; MIM 300161). The rate of formation of the ternary complex is modulated by the phosphorylation state of EIF2-alpha (Ernst et al., 1987 [PubMed 2948954]).[supplied by OMIM, Feb 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401321 | EIF2S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401321 | Transient overexpression lysate of eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1) |
CNY 3080.00 |
|
| TP300368 | Recombinant protein of human eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa (EIF2S1), 20 µg |
CNY 2900.00 |
其它elF2 alpha产品
