MAPKAP Kinase 3 (MAPKAPK3) (NM_004635) Human Mass Spec Standard
CAT#: PH300358
MAPKAPK3 MS Standard C13 and N15-labeled recombinant protein (NP_004626)
View other "MAPKAP Kinase 3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MAPKAPK3 MS Standard C13 and N15-labeled recombinant protein (NP_004626) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200358 |
| Predicted MW | 43 kDa |
| Protein Sequence |
>RC200358 protein sequence
Red=Cloning site Green=Tags(s) MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLECFHRRTGQKC ALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMECMEGGELFSRIQERGDQAFTE REAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVA PEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQL IRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVK IKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004626 |
| RefSeq Size | 2553 |
| RefSeq ORF | 1146 |
| Synonyms | 3PK; MAPKAP-K3; MAPKAP3; MAPKAPK-3; MDPT3; MK-3; MK3 |
| Locus ID | 7867 |
| Cytogenetics | 3p21.2 |
| Summary | This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | MAPK signaling pathway, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401470 | MAPKAPK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401470 | Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 3 (MAPKAPK3) |
CNY 3080.00 |
|
| TP300358 | Recombinant protein of human mitogen-activated protein kinase-activated protein kinase 3 (MAPKAPK3), 20 µg |
CNY 2900.00 |
其它MAPKAP Kinase 3产品
