CDK5 (NM_004935) Human Mass Spec Standard
CAT#: PH300342
CDK5 MS Standard C13 and N15-labeled recombinant protein (NP_004926)
View other "CDK5" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CDK5 MS Standard C13 and N15-labeled recombinant protein (NP_004926) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200342 |
| Predicted MW | 33.3 kDa |
| Protein Sequence |
>RC200342 protein sequence
Red=Cloning site Green=Tags(s) MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL HSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGEL KLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDD QLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEA LQHPYFSDFCPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004926 |
| RefSeq Size | 1211 |
| RefSeq ORF | 876 |
| Synonyms | LIS7; PSSALRE |
| Locus ID | 1020 |
| Cytogenetics | 7q36.1 |
| Summary | This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Alzheimer's disease, Axon guidance |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401536 | CDK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431225 | CDK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401536 | Transient overexpression lysate of cyclin-dependent kinase 5 (CDK5), transcript variant 1 |
CNY 3080.00 |
|
| LY431225 | Transient overexpression lysate of cyclin-dependent kinase 5 (CDK5), transcript variant 2 |
CNY 3080.00 |
|
| TP300342 | Recombinant protein of human cyclin-dependent kinase 5 (CDK5), 20 µg |
CNY 2900.00 |
