GRB7 (NM_001030002) Human Mass Spec Standard
CAT#: PH300330
GRB7 MS Standard C13 and N15-labeled recombinant protein (NP_001025173)
View other "GRB7" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | GRB7 MS Standard C13 and N15-labeled recombinant protein (NP_001025173) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200330 |
| Predicted MW | 59.7 kDa |
| Protein Sequence |
>RC200330 protein sequence
Red=Cloning site Green=Tags(s) MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNP FPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD ETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDA HTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNE SNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQ SRHLHPSCLGSPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGR LYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001025173 |
| RefSeq Size | 2130 |
| RefSeq ORF | 1596 |
| Locus ID | 2886 |
| Cytogenetics | 17q12 |
| Summary | The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
| Protein Families | Druggable Genome, Embryonic stem cells, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401639 | GRB7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422282 | GRB7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401639 | Transient overexpression lysate of growth factor receptor-bound protein 7 (GRB7), transcript variant 1 |
CNY 3080.00 |
|
| LY422282 | Transient overexpression lysate of growth factor receptor-bound protein 7 (GRB7), transcript variant 2 |
CNY 3080.00 |
|
| TP300330 | Recombinant protein of human growth factor receptor-bound protein 7 (GRB7), transcript variant 2, 20 µg |
CNY 2900.00 |
