Angiopoietin like 7 (ANGPTL7) (NM_021146) Human Mass Spec Standard
CAT#: PH300321
ANGPTL7 MS Standard C13 and N15-labeled recombinant protein (NP_066969)
View other "Angiopoietin like 7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ANGPTL7 MS Standard C13 and N15-labeled recombinant protein (NP_066969) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200321 |
| Predicted MW | 40 kDa |
| Protein Sequence |
>RC200321 protein sequence
Red=Cloning site Green=Tags(s) MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQ ERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYR ISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIH RLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDN CLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_066969 |
| RefSeq Size | 2307 |
| RefSeq ORF | 1038 |
| Synonyms | AngX; CDT6; dJ647M16.1 |
| Locus ID | 10218 |
| Cytogenetics | 1p36.22 |
| Summary | Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure (PubMed:21199193). Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency (PubMed:25622036).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402846 | ANGPTL7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402846 | Transient overexpression lysate of angiopoietin-like 7 (ANGPTL7) |
CNY 3080.00 |
|
| TP300321 | Recombinant protein of human angiopoietin-like 7 (ANGPTL7), 20 µg |
CNY 2900.00 |
其它Angiopoietin like 7产品
