LSM1 (NM_014462) Human Mass Spec Standard
CAT#: PH300288
LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277)
View other "LSM1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200288 |
| Predicted MW | 15.2 kDa |
| Protein Sequence |
>RC200288 protein sequence
Red=Cloning site Green=Tags(s) MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055277 |
| RefSeq Size | 1161 |
| RefSeq ORF | 399 |
| Synonyms | CASM; YJL124C |
| Locus ID | 27257 |
| Cytogenetics | 8p11.23 |
| Summary | This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415265 | LSM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415265 | Transient overexpression lysate of LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) |
CNY 3080.00 |
|
| TP300288 | Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), 20 µg |
CNY 2900.00 |
|
| TP720235 | Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) |
CNY 1800.00 |
