SCAMP2 (NM_005697) Human Mass Spec Standard
CAT#: PH300262
SCAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_005688)
View other "SCAMP2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SCAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_005688) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200262 |
| Predicted MW | 36.6 kDa |
| Protein Sequence |
>RC200262 protein sequence
Red=Cloning site Green=Tags(s) MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPT QPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE IPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAF RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV FLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005688 |
| RefSeq Size | 1313 |
| RefSeq ORF | 987 |
| Locus ID | 10066 |
| Cytogenetics | 15q24.1 |
| Summary | This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417127 | SCAMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417127 | Transient overexpression lysate of secretory carrier membrane protein 2 (SCAMP2) |
CNY 3080.00 |
|
| TP300262 | Recombinant protein of human secretory carrier membrane protein 2 (SCAMP2), 20 µg |
CNY 2900.00 |
