RAB31 (NM_006868) Human Mass Spec Standard
CAT#: PH300249
RAB31 MS Standard C13 and N15-labeled recombinant protein (NP_006859)
View other "RAB31" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB31 MS Standard C13 and N15-labeled recombinant protein (NP_006859) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200249 |
| Predicted MW | 21.7 kDa |
| Protein Sequence |
>RC200249 protein sequence
Red=Cloning site Green=Tags(s) MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHS LAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAES IGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006859 |
| RefSeq Size | 4009 |
| RefSeq ORF | 585 |
| Synonyms | Rab22B |
| Locus ID | 11031 |
| Cytogenetics | 18p11.22 |
| Summary | Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting (Bao et al., 2002 [PubMed 11784320]).[supplied by OMIM, Jul 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402053 | RAB31 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402053 | Transient overexpression lysate of RAB31, member RAS oncogene family (RAB31) |
CNY 3080.00 |
|
| TP300249 | Recombinant protein of human RAB31, member RAS oncogene family (RAB31), 20 µg |
CNY 2900.00 |
