CLEC4E (NM_014358) Human Mass Spec Standard
CAT#: PH300244
CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173)
View other "CLEC4E" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200244 |
| Predicted MW | 25.1 kDa |
| Protein Sequence |
>RC200244 protein sequence
Red=Cloning site Green=Tags(s) MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI NPLNKGKSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055173 |
| RefSeq Size | 2158 |
| RefSeq ORF | 657 |
| Synonyms | CLECSF9; MINCLE |
| Locus ID | 26253 |
| Cytogenetics | 12p13.31 |
| Summary | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415339 | CLEC4E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415339 | Transient overexpression lysate of C-type lectin domain family 4, member E (CLEC4E) |
CNY 3080.00 |
|
| TP300244 | Recombinant protein of human C-type lectin domain family 4, member E (CLEC4E), 20 µg |
CNY 2900.00 |
|
| TP720695 | Purified recombinant protein of Human C-type lectin domain family 4, member E (CLEC4E) |
CNY 1800.00 |
