TMCO1 (NM_019026) Human Mass Spec Standard
CAT#: PH300219
TMCO1 MS Standard C13 and N15-labeled recombinant protein (NP_061899)
View other "TMCO1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TMCO1 MS Standard C13 and N15-labeled recombinant protein (NP_061899) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200219 |
| Predicted MW | 21.2 kDa |
| Protein Sequence |
>RC200219 protein sequence
Red=Cloning site Green=Tags(s) MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIE RQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTD CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061899 |
| RefSeq Size | 4478 |
| RefSeq ORF | 564 |
| Synonyms | HP10122; PCIA3; PNAS-136; TMCC4 |
| Locus ID | 54499 |
| Cytogenetics | 1q24.1 |
| Summary | This locus encodes a transmembrane protein. Mutations at this locus have been associated with craniofacial dysmorphism, skeletal anomalies, and cognitive disability. Mutations at this locus have also been associated with open angle glaucoma blindness. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402729 | TMCO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402729 | Transient overexpression lysate of transmembrane and coiled-coil domains 1 (TMCO1) |
CNY 3080.00 |
|
| TP300219 | Recombinant protein of human transmembrane and coiled-coil domains 1 (TMCO1), 20 µg |
CNY 2900.00 |
