NUDT5 (NM_014142) Human Mass Spec Standard
CAT#: PH300204
NUDT5 MS Standard C13 and N15-labeled recombinant protein (NP_054861)
View other "NUDT5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NUDT5 MS Standard C13 and N15-labeled recombinant protein (NP_054861) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200204 |
| Predicted MW | 24.3 kDa |
| Protein Sequence |
>RC200204 protein sequence
Red=Cloning site Green=Tags(s) MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQR TLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCT IHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAK PFEVPFLKF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_054861 |
| RefSeq Size | 1224 |
| RefSeq ORF | 657 |
| Synonyms | hNUDT5; YSA1; YSA1H; YSAH1 |
| Locus ID | 11164 |
| Cytogenetics | 10p14 |
| Summary | This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors. [provided by RefSeq, Aug 2013] |
| Protein Pathways | Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415472 | NUDT5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415472 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5) |
CNY 3080.00 |
|
| TP300204 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 5 (NUDT5), 20 µg |
CNY 2900.00 |
