NDE1 (NM_017668) Human Mass Spec Standard
CAT＃: PH300179
NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_060138)
View other "NDE1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_060138) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200179 |
| Predicted MW | 37.7 kDa |
| Protein Sequence |
>RC200179 protein sequence
Red=Cloning site Green=Tags(s) MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNR LRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATG SVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYD QSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060138 |
| RefSeq Size | 3222 |
| RefSeq ORF | 1005 |
| Synonyms | HOM-TES-87; LIS4; MHAC; NDE; NUDE; NUDE1 |
| Locus ID | 54820 |
| Cytogenetics | 16p13.11 |
| Summary | This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402606 | NDE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428439 | NDE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402606 | Transient overexpression lysate of nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 2 |
CNY 3080.00 |
|
| LY428439 | Transient overexpression lysate of nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 1 |
CNY 3080.00 |
|
| PH327919 | NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_001137451) |
CNY 19520.00 |
|
| TP300179 | Recombinant protein of human nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP327919 | Recombinant protein of human nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 1, 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
