WDR5 (NM_052821) Human Mass Spec Standard
CAT＃: PH300162
WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_438172)
View other "WDR5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_438172) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200162 |
| Predicted MW | 36.6 kDa |
| Protein Sequence |
>RC200162 protein sequence
Red=Cloning site Green=Tags(s) MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_438172 |
| RefSeq Size | 3078 |
| RefSeq ORF | 1002 |
| Synonyms | BIG-3; CFAP89; SWD3 |
| Locus ID | 11091 |
| Cytogenetics | 9q34.2 |
| Summary | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402599 | WDR5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409441 | WDR5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402599 | Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 1 |
CNY 3080.00 |
|
| LY409441 | Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 2 |
CNY 3080.00 |
|
| PH316218 | WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_060058) |
CNY 19520.00 |
|
| TP300162 | Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP316218 | Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 1, 20 µg |
CNY 2900.00 |
