RBM23 (NM_018107) Human Mass Spec Standard
CAT＃: PH300138
RBM23 MS Standard C13 and N15-labeled recombinant protein (NP_060577)
View other "RBM23" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | RBM23 MS Standard C13 and N15-labeled recombinant protein (NP_060577) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200138 |
| Predicted MW | 46.8 kDa |
| Protein Sequence |
>RC200138 protein sequence
Red=Cloning site Green=Tags(s) MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRR RNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSPVREPVD NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLAIGL TGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMK DSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGTDITFPDGDQELDLGSAGGR FQLMAKLAEGAGIQLPSTAAAAAAAAAAQAAALQLNGAVPLGALNPAALTALSPALNLASQCFQLSSLFT PQTM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060577 |
| RefSeq Size | 2576 |
| RefSeq ORF | 1272 |
| Synonyms | CAPERbeta; PP239; RNPC4 |
| Locus ID | 55147 |
| Cytogenetics | 14q11.2 |
| Summary | This gene encodes a member of the U2AF-like family of RNA binding proteins. This protein interacts with some steroid nuclear receptors, localizes to the promoter of a steroid- responsive gene, and increases transcription of steroid-responsive transcriptional reporters in a hormone-dependent manner. It is also implicated in the steroid receptor-dependent regulation of alternative splicing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413294 | RBM23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421400 | RBM23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421401 | RBM23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413294 | Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 2 |
CNY 3080.00 |
|
| LY421400 | Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 1 |
CNY 4840.00 |
|
| LY421401 | Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 3 |
CNY 3080.00 |
|
| TP300138 | Recombinant protein of human RNA binding motif protein 23 (RBM23), transcript variant 2, 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
