RAI3 (GPRC5A) (NM_003979) Human Mass Spec Standard
CAT#: PH300118
GPRC5A MS Standard C13 and N15-labeled recombinant protein (NP_003970)
View other "RAI3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GPRC5A MS Standard C13 and N15-labeled recombinant protein (NP_003970) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200118 |
| Predicted MW | 40.3 kDa |
| Protein Sequence |
>RC200118 protein sequence
Red=Cloning site Green=Tags(s) MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY EVKKEGS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003970 |
| RefSeq Size | 2856 |
| RefSeq ORF | 1071 |
| Synonyms | GPCR5A; PEIG-1; RAI3; RAIG1; TIG1 |
| Locus ID | 9052 |
| Cytogenetics | 12p13.1 |
| Summary | This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401304 | GPRC5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401304 | Transient overexpression lysate of G protein-coupled receptor, family C, group 5, member A (GPRC5A) |
CNY 3080.00 |
|
| TP300118 | Recombinant protein of human G protein-coupled receptor, family C, group 5, member A (GPRC5A), 20 µg |
CNY 2900.00 |
