SKIP (INPP5K) (NM_016532) Human Mass Spec Standard
CAT#: PH300092
INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616)
View other "SKIP" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200092 |
| Predicted MW | 51.1 kDa |
| Protein Sequence |
>RC200092 protein sequence
Red=Cloning site Green=Tags(s) MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR SVVGISRPFQIPPGSLREDPLGEAQPQI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057616 |
| RefSeq Size | 3001 |
| RefSeq ORF | 1344 |
| Synonyms | MDCCAID; PPS; SKIP |
| Locus ID | 51763 |
| Cytogenetics | 17p13.3 |
| Summary | This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Phosphatase |
| Protein Pathways | Inositol phosphate metabolism, Insulin signaling pathway, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402561 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408929 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427643 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402561 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1 |
CNY 3080.00 |
|
| LY408929 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2 |
CNY 3080.00 |
|
| LY427643 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3 |
CNY 3080.00 |
|
| PH312090 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_570122) |
CNY 19520.00 |
|
| PH327852 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114) |
CNY 19520.00 |
|
| TP300092 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP312090 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP327852 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 20 µg |
CNY 2900.00 |
