PDAP1 (NM_014891) Human Mass Spec Standard
CAT#: PH300058
PDAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055706)
View other "PDAP1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PDAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055706) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200058 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC200058 protein sequence
Red=Cloning site Green=Tags(s) MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055706 |
RefSeq Size | 2707 |
RefSeq ORF | 543 |
Synonyms | HASPP28; PAP; PAP1 |
Locus ID | 11333 |
Cytogenetics | 7q22.1 |
Summary | The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. [provided by RefSeq, Dec 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402386 | PDAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402386 | Transient overexpression lysate of PDGFA associated protein 1 (PDAP1) |
CNY 3080.00 |
|
TP300058 | Recombinant protein of human PDGFA associated protein 1 (PDAP1), 20 µg |
CNY 2900.00 |
|
TP720268 | Recombinant protein of human PDGFA associated protein 1 (PDAP1) |
CNY 1800.00 |