PDAP1 (NM_014891) Human Mass Spec Standard
CAT#: PH300058
PDAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055706)
View other "PDAP1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PDAP1 MS Standard C13 and N15-labeled recombinant protein (NP_055706) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200058 |
| Predicted MW | 20.6 kDa |
| Protein Sequence |
>RC200058 protein sequence
Red=Cloning site Green=Tags(s) MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDY QQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADL ARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055706 |
| RefSeq Size | 2707 |
| RefSeq ORF | 543 |
| Synonyms | HASPP28; PAP; PAP1 |
| Locus ID | 11333 |
| Cytogenetics | 7q22.1 |
| Summary | The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. [provided by RefSeq, Dec 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402386 | PDAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402386 | Transient overexpression lysate of PDGFA associated protein 1 (PDAP1) |
CNY 3080.00 |
|
| TP300058 | Recombinant protein of human PDGFA associated protein 1 (PDAP1), 20 µg |
CNY 2900.00 |
|
| TP720268 | Recombinant protein of human PDGFA associated protein 1 (PDAP1) |
CNY 1800.00 |
