EMC9 (NM_016049) Human Mass Spec Standard
CAT#: PH300034
FAM158A MS Standard C13 and N15-labeled recombinant protein (NP_057133)
View other "EMC9" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FAM158A MS Standard C13 and N15-labeled recombinant protein (NP_057133) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200034 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC200034 protein sequence
Red=Cloning site Green=Tags(s) MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVW GAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRW VPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057133 |
RefSeq Size | 896 |
RefSeq ORF | 624 |
Synonyms | C14orf122; CGI-112; FAM158A |
Locus ID | 51016 |
Cytogenetics | 14q12 |
Summary | Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed:30415835, PubMed:29809151, PubMed:29242231, PubMed:32459176). Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues (PubMed:30415835, PubMed:29809151, PubMed:29242231). Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices (PubMed:30415835, PubMed:29809151). It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes (PubMed:29809151, PubMed:29242231). By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors (PubMed:30415835). By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414216 | EMC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414216 | Transient overexpression lysate of family with sequence similarity 158, member A (FAM158A) |
CNY 3080.00 |
|
TP300034 | Recombinant protein of human family with sequence similarity 158, member A (FAM158A), 20 µg |
CNY 2900.00 |