NDUFAF1 (NM_016013) Human Mass Spec Standard
CAT#: PH300029
NDUFAF1 MS Standard C13 and N15-labeled recombinant protein (NP_057097)
View other "NDUFAF1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NDUFAF1 MS Standard C13 and N15-labeled recombinant protein (NP_057097) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200029 |
| Predicted MW | 37.8 kDa |
| Protein Sequence |
>RC200029 protein sequence
Red=Cloning site Green=Tags(s) MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALD ITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVVWQFRGKEDLDKWTVTS DKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRSGYCAMISRIPRGAFERKMSYDWSQFNTLYL RVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKIS SIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYENSPELNPRLFK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057097 |
| RefSeq Size | 1488 |
| RefSeq ORF | 981 |
| Synonyms | CGI-65; CGI65; CIA30; MC1DN11 |
| Locus ID | 51103 |
| Cytogenetics | 15q15.1 |
| Summary | This gene encodes a complex I assembly factor protein. Complex I (NADH-ubiquinone oxidoreductase) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. The encoded protein is required for assembly of complex I, and mutations in this gene are a cause of mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 19. [provided by RefSeq, Dec 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414253 | NDUFAF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414253 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 1 (NDUFAF1) |
CNY 3080.00 |
|
| TP300029 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 1 (NDUFAF1), 20 µg |
CNY 2900.00 |
其它NDUFAF1产品
