PPIL1 (NM_016059) Human Mass Spec Standard
CAT#: PH300015
PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143)
View other "PPIL1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200015 |
| Predicted MW | 18.2 kDa |
| Protein Sequence |
>RC200015 protein sequence
Red=Cloning site Green=Tags(s) MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVN RVGMVETNSQDRPVDDVKIIKAYPSG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057143 |
| RefSeq Size | 1750 |
| RefSeq ORF | 498 |
| Synonyms | CGI-124; CYPL1; hCyPX; PCH14; PPIase |
| Locus ID | 51645 |
| Cytogenetics | 6p21.2 |
| Summary | This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414224 | PPIL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414224 | Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) |
CNY 3080.00 |
|
| TP300015 | Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), 20 µg |
CNY 2900.00 |
|
| TP720261 | Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) |
CNY 1800.00 |

