E Cadherin (CDH1) (NM_004360) Human Mutant ORF Clone

CAT#: RC400186

  • TrueORF®

CDH1 Mutant (L14fs*), Myc-DDK-tagged ORF clone of Homo sapiens cadherin 1, type 1, E-cadherin (epithelial) (CDH1) as transfection-ready DNA



Need custom modification / cloning service?
Get a free quote

CNY 3990.00


货期*
3周

规格
    • 10 ug

Product images

Specifications

Product Data
Product Name E Cadherin (CDH1) (NM_004360) Human Mutant ORF Clone
Mutation Description L14fs*
Affected Codon# 14
Affected NT# c. 41
Nucleotide Mutation CDH1 Mutant (L14fs*), Myc-DDK-tagged ORF clone of Homo sapiens cadherin 1, type 1, E-cadherin (epithelial) (CDH1) as transfection-ready DNA
Effect Frameshift
Synonyms Arc-1; BCDS1; CD324; CDHE; ECAD; LCAM; UVO
Vector pCMV6-Entry
Tag Myc-DDK
ACCN NM_004360
ORF Size 162 bp
Sequence Data
>RC400186 representing NM_004360
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCGCTGCAGGTCTCCTCTTGGCTCTGCCAGGA
GCCGGAGCCCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAG
AGAGGCCGCGTCCTGGGCAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC400186 representing NM_004360
Red=Cloning site Green=Tags(s)

MGPWSRSLSALLLRCRSPLGSARSRSPATLALTPRATRSRCPGATWREAASWAE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NP_004351
RefSeq Size 4815 bp
RefSeq ORF 2649 bp
Locus ID 999
Domains Cadherin_C_term, CA
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Adherens junction, Bladder cancer, Cell adhesion molecules (CAMs), Endometrial cancer, Melanoma, Pathogenic Escherichia coli infection, Pathways in cancer, Thyroid cancer
MW 5 kDa
Gene Summary This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16. [provided by RefSeq, Nov 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...