p53 (TP53) (NM_000546) Human Mutant ORF Clone
CAT#: RC400064
- TrueORF®
TP53 mutant (R248Q), Myc-DDK-tagged ORF clone of Homo sapiens tumor protein p53 (TP53), transcript variant 1 as transfection-ready DNA
Need custom modification / cloning service?
Get a free quote
CNY 3656.00
CNY 6270.00
货期*
现货
规格
Product images
Specifications
| Product Data | |
| Product Name | p53 (TP53) (NM_000546) Human Mutant ORF Clone |
| Mutation Description | R248Q |
| Affected Codon# | 248 |
| Affected NT# | c.743 |
| Nucleotide Mutation | TP53 mutant (R248Q), Myc-DDK-tagged ORF clone of Homo sapiens tumor protein p53 (TP53), transcript variant 1 as transfection-ready DNA |
| Effect | Missense |
| Synonyms | BCC7; BMFS5; LFS1; P53; TRP53 |
| Vector | pCMV6-AC-Myc-DDK |
| Tag | Myc-DDK |
| ACCN | NM_000546 |
| ORF Size | 1182 bp |
| Sequence Data |
>RC400064 representing NM_000546
Red=Cloning site Green=Tags(s) MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNQRPILTIITLEDSSGNLLGRNSFEVRVCACPGR DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALEL KDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Reference Data | |
| RefSeq | NP_000537 |
| RefSeq Size | 2629 bp |
| RefSeq ORF | 1182 bp |
| Locus ID | 7157 |
| Domains | P53 |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Basal cell carcinoma, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, Glioma, Huntington's disease, MAPK signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer, Thyroid cancer, Wnt signaling pathway |
| MW | 43.6 kDa |
| Gene Summary | This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277). [provided by RefSeq, Dec 2016] |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
You may also need
Customer
Reviews
Loading...

