P2-B polypeptide (NC_001617) Virus Tagged ORF Clone
CAT#: VC102123
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for P2-B polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740396
View other clones from "Virus" (9)
Need custom modification / cloning service?
Get a free quote
CNY 3800.00
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102123 represents NCBI reference of NP_740396 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGGCTGAGCGACTACGTGGAGCACCTCGGGCAGGTGTTTGGCGTGGGGTTCGTGGATAGTATAAAAC AACAGGTCAATTTCATTAATCCAACTTCCAAAATCGGCAGTAAGGTGATAAAATGGCTGCTCCGGATTGT GTCCGCCATGATCATCATGGTAAGAAATTCTAGTGATCCACAGACCGTGATTGCAACGCTCACACTCCTG GGCTGCTCCGGTTCCCCCTGGAGATTCCTCAAAGAAAAGCTCTGCGCTTGGCTGCAGCTGAGTTATGTGC ATAAACAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102123 representing NP_740396
Red=Cloning sites Green=Tags MGLSDYVEHLGQVFGVGFVDSIKQQVNFINPTSKIGSKVIKWLLRIVSAMIIMVRNSSDPQTVIATLTLL GCSGSPWRFLKEKLCAWLQLSYVHKQ TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001617 |
ORF Size | 288 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001617.1, NP_740396 |
RefSeq ORF | 288 bp |
MW | 10.8 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102118 | Myc-DDK-tagged ORF clone of viral ORF for VP4 polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740391 |
CNY 3800.00 |
|
VC102119 | Myc-DDK-tagged ORF clone of viral ORF for VP2 polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740392 |
CNY 3800.00 |
|
VC102120 | Myc-DDK-tagged ORF clone of viral ORF for VP3 polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740393 |
CNY 3800.00 |
|
VC102121 | Myc-DDK-tagged ORF clone of viral ORF for VP1 polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740394 |
CNY 3800.00 |
|
VC102122 | Myc-DDK-tagged ORF clone of viral ORF for P2-A polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740395 |
CNY 3800.00 |
|
VC102124 | Myc-DDK-tagged ORF clone of viral ORF for P2-C polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740397 |
CNY 3800.00 |
|
VC102125 | Myc-DDK-tagged ORF clone of viral ORF for P-3A polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740398 |
CNY 3800.00 |
|
VC102126 | Myc-DDK-tagged ORF clone of viral ORF for VPg polypeptide [Human rhinovirus A], codon optimized for human cell expression, NP_740399 |
CNY 3800.00 |
|
VC102127 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human rhinovirus A], codon optimized for human cell expression, NP_740400 |
CNY 3800.00 |
其它P2-B polypeptide产品