U4 (NC_000898) Virus Tagged ORF Clone
CAT#: VC101449
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp009 [Human herpesvirus 6], codon optimized for human cell expression, NP_050186
View other clones from "Virus" (98)
Need custom modification / cloning service?
Get a free quote
CNY 6460.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>The Viral ORF clone VC101449 represents NCBI reference of NP_050186 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAACTGCTCGACCACGACATCTACAAGGGTCCTGTTCGAGAAAGGGTAACATACACTATACCCAATC ACCCCTATCTTTCCCTCACTGTTCACCACAGTCGCGAACTGGATGTGGACCTCAAAGATATTACAGAAGA AATGATCATTGACAGCGGGACCCTGACCGCTGAGGACCTGTTCATGACTAGAGGACTCAGATTCTGTGAC GACAGTGTGCTTTGGGCTGCCCTGGCTGAAAAGGTATCCGTGGAGTTCCAGCGCCGGGGAAAAACTACTA TGGATTTGTCAGCATTTATGTCCCTCCTGGAGCGGCTCACTTTTGAGGACGAGACAAGCGCCTTTTACCG GCTGCTGACCAAGTGTACCGCGCTCGCCCACTTCAGCATACTGGAGTACATCGTGGACGGCGAAAAGAGA GATACTATCTCAGCCCATTTTAACCGGCTCCTCGAATTGCTGGACTCTCTGTTCCTGCAATTCCTCATGC TTAGGAACCGATCTGAAAGTAATACGTTGCTCACACTTTTCGACATCCTGCCTAACCCAAAGGAAATCTA TGGAGATGCTGCAAGCCCCACGTCCGTCCTCTTGAAGCACTTCCTGAGCGACTACATTTTTGTGGCCTAT GCCTCCTCCTACAGATTCGTGTCTAGCGTATTGTGCTCTTGCGATCAGTGTCGCGCCAGCTTGTTCCGCA TCTATCTGGGTAAGAAAGATAGCCGGGCAGTGAATATTTCTGACATCTCCGAGTTCGATCCCGCCGACCT CATCCTGGGTCAGCTGCACCTGGACGCTAGGGAAGCCGTTGCCTTGCGCGCTGAGATTGACCGGGACCTG GGATCTTCTCTGATCCTGAATAGTATGGAGAGAAGGCACCTCCCAATCCTCCACGACAAACAGCTCGGGC GCGGACATTTTGAGAGGAACATTCTCAAGGTTTATTGTAATATTGTCCTGTGCCTGTTTCTCTTGCGCCG AGTAAAACAAAGAATCGTCTCCGATCTGACAGCTATTGCGAGGTTCTTCGTCAAAGCAATTTCTGAGATG GAACGCTGCATCGATACTGTCTCAGGATTGCACGGTGTTAGAATAAAGCTTCTCGTGGTGTCCAGTCAGT TTGAGATAAAAGACCCAATGCGCGTTCCACGGCTGTGCTTCTTTTTCCTTGAGATCGTAACTATCCTCGT TTCCGGCTACGATAAGGAGCGGCACCGAGTGCGGGCACTGCTTGAGCATCTGTGTCTGAAAAAGATTTGT CTTGGCGACCTGTGTGCAAGCATGAGACTCGCACGCGAGATCCGCCACGATGTGTTGGAGGGCTTTCTGA ACACCCTGGAGCTGTCTTACATGAGCAACCCAGTGCGGTTTTTCCGATTTCACGATTGCAACTTGTATGG CACACACATGTGGTCCGGCGTTTACCCTAACGTCGTTCCTTACGCAGTCAGAGGGGGGGGGTCATTCGAC ATCAGGTTGCAAGAGCATCGCAGACGGCAAAAAAGGATAGTCCTCAGAAGGAGGTTGATTCGCAGGGTCC AGCAGAGGGGATTGGACATCCGAGAGGCAAGACGGGTCCCGAAGCTCGCTTGTGTGACTTTTATA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101449 representing NP_050186
Red=Cloning sites Green=Tags MELLDHDIYKGPVRERVTYTIPNHPYLSLTVHHSRELDVDLKDITEEMIIDSGTLTAEDLFMTRGLRFCD DSVLWAALAEKVSVEFQRRGKTTMDLSAFMSLLERLTFEDETSAFYRLLTKCTALAHFSILEYIVDGEKR DTISAHFNRLLELLDSLFLQFLMLRNRSESNTLLTLFDILPNPKEIYGDAASPTSVLLKHFLSDYIFVAY ASSYRFVSSVLCSCDQCRASLFRIYLGKKDSRAVNISDISEFDPADLILGQLHLDAREAVALRAEIDRDL GSSLILNSMERRHLPILHDKQLGRGHFERNILKVYCNIVLCLFLLRRVKQRIVSDLTAIARFFVKAISEM ERCIDTVSGLHGVRIKLLVVSSQFEIKDPMRVPRLCFFFLEIVTILVSGYDKERHRVRALLEHLCLKKIC LGDLCASMRLAREIRHDVLEGFLNTLELSYMSNPVRFFRFHDCNLYGTHMWSGVYPNVVPYAVRGGGSFD IRLQEHRRRQKRIVLRRRLIRRVQQRGLDIREARRVPKLACVTFI TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_000898 |
| ORF Size | 1605 bp |
| OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NC_000898.1, NP_050186 |
| RefSeq ORF | 1605 bp |
| Locus ID | 1497007 |
| MW | 62.0 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC101440 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase II [Human herpesvirus 6], codon optimized for human cell expression, NP_050176 |
CNY 11500.00 |
|
| VC101441 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050180 |
CNY 4660.00 |
|
| VC101442 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp004 [Human herpesvirus 6], codon optimized for human cell expression, NP_050179 |
CNY 3800.00 |
|
| VC101443 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp003 [Human herpesvirus 6], codon optimized for human cell expression, NP_050178 |
CNY 3800.00 |
|
| VC101444 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp002 [Human herpesvirus 6], codon optimized for human cell expression, NP_050177 |
CNY 3800.00 |
|
| VC101445 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp006 [Human herpesvirus 6], codon optimized for human cell expression, NP_050181 |
CNY 3800.00 |
|
| VC101447 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050183 |
CNY 3800.00 |
|
| VC101448 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050185 |
CNY 4560.00 |
|
| VC101450 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp014 [Human herpesvirus 6], codon optimized for human cell expression, NP_050188 |
CNY 3800.00 |
|
| VC101451 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp012 [Human herpesvirus 6], codon optimized for human cell expression, NP_050189 |
CNY 4940.00 |
|
| VC101452 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp015 [Human herpesvirus 6], codon optimized for human cell expression, NP_050190 |
CNY 3800.00 |
|
| VC101453 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp016 [Human herpesvirus 6], codon optimized for human cell expression, NP_050191 |
CNY 6080.00 |
|
| VC101454 | Myc-DDK-tagged ORF clone of viral ORF for antigenic virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050192 |
CNY 9424.00 |
|
| VC101455 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp019 [Human herpesvirus 6], codon optimized for human cell expression, NP_050194 |
CNY 3800.00 |
|
| VC101456 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp020 [Human herpesvirus 6], codon optimized for human cell expression, NP_050195 |
CNY 7320.00 |
|
| VC101457 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 6 [Human herpesvirus 6], codon optimized for human cell expression, NP_050198 |
CNY 3800.00 |
|
| VC101458 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein 4 [Human herpesvirus 6], codon optimized for human cell expression, NP_050199 |
CNY 4660.00 |
|
| VC101459 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050200 |
CNY 5320.00 |
|
| VC101460 | Myc-DDK-tagged ORF clone of viral ORF for putative membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050201 |
CNY 6080.00 |
|
| VC101461 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp013 [Human herpesvirus 6], codon optimized for human cell expression, NP_050187 |
CNY 13590.00 |
|
| VC101462 | Myc-DDK-tagged ORF clone of viral ORF for transcription regulator [Human herpesvirus 6], codon optimized for human cell expression, NP_050197 |
CNY 3990.00 |
|
| VC101463 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050202 |
CNY 3800.00 |
|
| VC101464 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp027 [Human herpesvirus 6], codon optimized for human cell expression, NP_050204 |
CNY 1200.00 |
|
| VC101465 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp026 [Human herpesvirus 6], codon optimized for human cell expression, NP_050205 |
CNY 3800.00 |
|
| VC101466 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp025 [Human herpesvirus 6], codon optimized for human cell expression, NP_050206 |
CNY 3800.00 |
|
| VC101467 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp033 [Human herpesvirus 6], codon optimized for human cell expression, NP_050207 |
CNY 3800.00 |
|
| VC101468 | Myc-DDK-tagged ORF clone of viral ORF for Polymerase processivity factor [Human herpesvirus 6], codon optimized for human cell expression, NP_050208 |
CNY 4370.00 |
|
| VC101469 | Myc-DDK-tagged ORF clone of viral ORF for large ribonuclease reductase [Human herpesvirus 6], codon optimized for human cell expression, NP_050209 |
CNY 12260.00 |
|
| VC101470 | Myc-DDK-tagged ORF clone of viral ORF for capsid assembly and DNA maturation [Human herpesvirus 6], codon optimized for human cell expression, NP_050210 |
CNY 3800.00 |
|
| VC101471 | Myc-DDK-tagged ORF clone of viral ORF for capsid assembly protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050211 |
CNY 16340.00 |
|
| VC101473 | Myc-DDK-tagged ORF clone of viral ORF for putative capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050213 |
CNY 3800.00 |
|
| VC101474 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050214 |
CNY 5700.00 |
|
| VC101475 | Myc-DDK-tagged ORF clone of viral ORF for putative virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050215 |
CNY 3800.00 |
|
| VC101476 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp038 [Human herpesvirus 6], codon optimized for human cell expression, NP_050216 |
CNY 3800.00 |
|
| VC101477 | Myc-DDK-tagged ORF clone of viral ORF for virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050217 |
CNY 5890.00 |
|
| VC101478 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp043 [Human herpesvirus 6], codon optimized for human cell expression, NP_050218 |
CNY 3800.00 |
|
| VC101479 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050219 |
CNY 15390.00 |
|
| VC101480 | Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein B [Human herpesvirus 6], codon optimized for human cell expression, NP_050220 |
CNY 12640.00 |
|
| VC101481 | Myc-DDK-tagged ORF clone of viral ORF for transport/capsid assembly [Human herpesvirus 6], codon optimized for human cell expression, NP_050221 |
CNY 10930.00 |
|
| VC101482 | Myc-DDK-tagged ORF clone of viral ORF for major DNA binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050222 |
CNY 17100.00 |
|
| VC101483 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050223 |
CNY 6270.00 |
|
| VC101484 | Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050224 |
CNY 13020.00 |
|
| VC101485 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp050 [Human herpesvirus 6], codon optimized for human cell expression, NP_050225 |
CNY 3800.00 |
|
| VC101486 | Myc-DDK-tagged ORF clone of viral ORF for putative dUTPase [Human herpesvirus 6], codon optimized for human cell expression, NP_050226 |
CNY 4470.00 |
|
| VC101487 | Myc-DDK-tagged ORF clone of viral ORF for putative membrane /secreted protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050227 |
CNY 3800.00 |
|
| VC101488 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein O [Human herpesvirus 6], codon optimized for human cell expression, NP_050228 |
CNY 11120.00 |
|
| VC101489 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein H [Human herpesvirus 6], codon optimized for human cell expression, NP_050229 |
CNY 10450.00 |
|
| VC101490 | Myc-DDK-tagged ORF clone of viral ORF for putative fusion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050230 |
CNY 3800.00 |
|
| VC101491 | Myc-DDK-tagged ORF clone of viral ORF for viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050231 |
CNY 6750.00 |
|
| VC101492 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050232 |
CNY 3800.00 |
|
| VC101493 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp058 [Human herpesvirus 6], codon optimized for human cell expression, NP_050233 |
CNY 3800.00 |
|
| VC101494 | Myc-DDK-tagged ORF clone of viral ORF for proteinase [Human herpesvirus 6], codon optimized for human cell expression, NP_050234 |
CNY 6370.00 |
|
| VC101495 | Myc-DDK-tagged ORF clone of viral ORF for virion transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050235 |
CNY 5610.00 |
|
| VC101496 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp062 [Human herpesvirus 6], codon optimized for human cell expression, NP_050236 |
CNY 5990.00 |
|
| VC101497 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050237 |
CNY 3800.00 |
|
| VC101498 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050238 |
CNY 20330.00 |
|
| VC101499 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp064 [Human herpesvirus 6], codon optimized for human cell expression, NP_050239 |
CNY 11690.00 |
|
| VC101500 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp065 [Human herpesvirus 6], codon optimized for human cell expression, NP_050240 |
CNY 4180.00 |
|
| VC101501 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp067 [Human herpesvirus 6], codon optimized for human cell expression, NP_050242 |
CNY 3800.00 |
|
| VC101502 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp068 [Human herpesvirus 6], codon optimized for human cell expression, NP_050243 |
CNY 3800.00 |
|
| VC101503 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050244 |
CNY 5420.00 |
|
| VC101504 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050245 |
CNY 3990.00 |
|
| VC101505 | Myc-DDK-tagged ORF clone of viral ORF for Putative terminase [Human herpesvirus 6], codon optimized for human cell expression, NP_050241 |
CNY 7980.00 |
|
| VC101506 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp071 [Human herpesvirus 6], codon optimized for human cell expression, NP_050246 |
CNY 4180.00 |
|
| VC101507 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp072 [Human herpesvirus 6], codon optimized for human cell expression, NP_050247 |
CNY 3800.00 |
|
| VC101508 | Myc-DDK-tagged ORF clone of viral ORF for Phosphotransferase [Human herpesvirus 6], codon optimized for human cell expression, NP_050248 |
CNY 6840.00 |
|
| VC101509 | Myc-DDK-tagged ORF clone of viral ORF for Alkaline exonuclease [Human herpesvirus 6], codon optimized for human cell expression, NP_050249 |
CNY 5990.00 |
|
| VC101510 | Myc-DDK-tagged ORF clone of viral ORF for Myristylated virion protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050250 |
CNY 3800.00 |
|
| VC101511 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein M [Human herpesvirus 6], codon optimized for human cell expression, NP_050251 |
CNY 4090.00 |
|
| VC101512 | Myc-DDK-tagged ORF clone of viral ORF for origin binding protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050252 |
CNY 11880.00 |
|
| VC101513 | Myc-DDK-tagged ORF clone of viral ORF for helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050253 |
CNY 7890.00 |
|
| VC101514 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp080 [Human herpesvirus 6], codon optimized for human cell expression, NP_050254 |
CNY 3800.00 |
|
| VC101515 | Myc-DDK-tagged ORF clone of viral ORF for putative viron protein [Human herpesvirus 6], codon optimized for human cell expression, NP_050255 |
CNY 7890.00 |
|
| VC101516 | Myc-DDK-tagged ORF clone of viral ORF for Helicase/primase complex [Human herpesvirus 6], codon optimized for human cell expression, NP_050256 |
CNY 12540.00 |
|
| VC101517 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp082 [Human herpesvirus 6], codon optimized for human cell expression, NP_050257 |
CNY 3800.00 |
|
| VC101518 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp083 [Human herpesvirus 6], codon optimized for human cell expression, NP_050258 |
CNY 3800.00 |
|
| VC101519 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication [Human herpesvirus 6], codon optimized for human cell expression, NP_050259 |
CNY 5890.00 |
|
| VC101520 | Myc-DDK-tagged ORF clone of viral ORF for Uracyl-DNA glycosylase [Human herpesvirus 6], codon optimized for human cell expression, NP_050260 |
CNY 3800.00 |
|
| VC101521 | Myc-DDK-tagged ORF clone of viral ORF for Glycoprotein L [Human herpesvirus 6], codon optimized for human cell expression, NP_050261 |
CNY 3800.00 |
|
| VC101522 | Myc-DDK-tagged ORF clone of viral ORF for Intercrine cytokine [Human herpesvirus 6], codon optimized for human cell expression, NP_050262 |
CNY 3800.00 |
|
| VC101523 | Myc-DDK-tagged ORF clone of viral ORF for putative glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050263 |
CNY 4090.00 |
|
| VC101524 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050264 |
CNY 3800.00 |
|
| VC101526 | Myc-DDK-tagged ORF clone of viral ORF for IE-A transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050266 |
CNY 16340.00 |
|
| VC101527 | Myc-DDK-tagged ORF clone of viral ORF for probable membrane glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050267 |
CNY 3800.00 |
|
| VC101529 | Myc-DDK-tagged ORF clone of viral ORF for Parvovirus rep homolog [Human herpesvirus 6], codon optimized for human cell expression, NP_050269 |
CNY 4024.00 |
|
| VC101530 | Myc-DDK-tagged ORF clone of viral ORF for immediate-early protein IE2 [Human herpesvirus 6], codon optimized for human cell expression, NP_050270 |
CNY 18340.00 |
|
| VC101531 | Myc-DDK-tagged ORF clone of viral ORF for spliced envelope glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050271 |
CNY 7410.00 |
|
| VC101533 | Myc-DDK-tagged ORF clone of viral ORF for putative DNA-directed RNA polymerase [Human herpesvirus 6], codon optimized for human cell expression, NP_050273 |
CNY 11500.00 |
|
| VC101534 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp099 [Human herpesvirus 6], codon optimized for human cell expression, NP_050274 |
CNY 3800.00 |
|
| VC101535 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp100 [Human herpesvirus 6], codon optimized for human cell expression, NP_050275 |
CNY 3800.00 |
|
| VC101536 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp101 [Human herpesvirus 6], codon optimized for human cell expression, NP_050276 |
CNY 3800.00 |
|
| VC101537 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050277 |
CNY 4660.00 |
|
| VC101538 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp103 [Human herpesvirus 6], codon optimized for human cell expression, NP_050278 |
CNY 3800.00 |
|
| VC101539 | Myc-DDK-tagged ORF clone of viral ORF for glycoprotein [Human herpesvirus 6], codon optimized for human cell expression, NP_050203 |
CNY 3800.00 |
|
| VC101540 | Myc-DDK-tagged ORF clone of viral ORF for hypothetical protein HhV6Bgp021 [Human herpesvirus 6], codon optimized for human cell expression, NP_050196 |
CNY 3800.00 |
|
| VC101541 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor [Human herpesvirus 6], codon optimized for human cell expression, NP_050193 |
CNY 3800.00 |
|
| VC101542 | Myc-DDK-tagged ORF clone of viral ORF for transactivator [Human herpesvirus 6], codon optimized for human cell expression, NP_050184 |
CNY 4370.00 |
|
| VC101543 | Myc-DDK-tagged ORF clone of viral ORF for G-protein coupled receptor fragment [Human herpesvirus 6], codon optimized for human cell expression, NP_597817 |
CNY 3800.00 |
