UL49 (NC_001806) Virus Tagged ORF Clone
CAT#: VC100837
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP22 [Human herpesvirus 1], codon optimized for human cell expression, NP_044651
View other clones from "Virus" (62)
Need custom modification / cloning service?
Get a free quote
CNY 3600.00
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100837 represents NCBI reference of NP_044651 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAAGCAGGCGCAGCGTGAAGAGTGGACCCAGGGAGGTGCCACGGGATGAATATGAGGACCTGTACT ATACCCCATCATCCGGCATGGCATCTCCGGACTCCCCCCCTGACACTTCACGGAGAGGAGCCCTGCAGAC TAGAAGCCGGCAGCGCGGCGAGGTTAGGTTCGTACAGTATGATGAGTCCGATTACGCCCTCTATGGCGGC AGTTCTTCCGAGGACGATGAACATCCCGAAGTGCCAAGGACTCGGAGACCTGTGAGCGGAGCTGTCTTGT CCGGCCCTGGTCCTGCAAGAGCTCCCCCTCCCCCGGCTGGATCAGGTGGAGCTGGCAGAACTCCTACTAC CGCCCCTAGAGCCCCCAGGACGCAAAGAGTGGCCACTAAGGCACCCGCTGCCCCCGCAGCAGAAACGACC CGGGGCCGGAAAAGTGCGCAGCCAGAGAGCGCAGCCCTCCCTGATGCACCAGCTAGCACAGCACCTACCA GAAGCAAAACACCAGCGCAGGGACTCGCTCGCAAACTGCACTTTAGCACAGCCCCCCCTAATCCAGACGC GCCGTGGACTCCCCGAGTTGCAGGGTTTAACAAGAGGGTTTTCTGTGCAGCTGTCGGACGGCTTGCTGCA ATGCATGCTAGGATGGCCGCTGTGCAGCTGTGGGACATGAGCCGACCCAGAACGGATGAGGATCTGAACG AACTTCTGGGCATCACCACTATTAGGGTAACCGTGTGCGAGGGTAAGAACCTGTTGCAGAGGGCAAATGA GCTTGTGAATCCAGATGTGGTTCAAGATGTGGATGCCGCCACTGCAACAAGGGGCCGCTCCGCCGCAAGC AGGCCTACCGAAAGACCCCGGGCTCCTGCCCGCTCTGCAAGCCGGCCCAGAAGACCAGTGGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100837 representing NP_044651
Red=Cloning sites Green=Tags MTSRRSVKSGPREVPRDEYEDLYYTPSSGMASPDSPPDTSRRGALQTRSRQRGEVRFVQYDESDYALYGG SSSEDDEHPEVPRTRRPVSGAVLSGPGPARAPPPPAGSGGAGRTPTTAPRAPRTQRVATKAPAAPAAETT RGRKSAQPESAALPDAPASTAPTRSKTPAQGLARKLHFSTAPPNPDAPWTPRVAGFNKRVFCAAVGRLAA MHARMAAVQLWDMSRPRTDEDLNELLGITTIRVTVCEGKNLLQRANELVNPDVVQDVDAATATRGRSAAS RPTERPRAPARSASRPRRPVE TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001806 |
ORF Size | 903 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001806.1, NP_044651 |
RefSeq ORF | 903 bp |
Locus ID | 2703417 |
UniProt ID | P04413 |
MW | 32.3 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100788 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 1], codon optimized for human cell expression, NP_044602 |
CNY 3840.00 |
|
VC100789 | Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 1], codon optimized for human cell expression, NP_044603 |
CNY 3990.00 |
|
VC100790 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL3 [Human herpesvirus 1], codon optimized for human cell expression, NP_044604 |
CNY 3800.00 |
|
VC100791 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL4 [Human herpesvirus 1], codon optimized for human cell expression, NP_044605 |
CNY 3800.00 |
|
VC100792 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044606 |
CNY 7104.00 |
|
VC100793 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044607 |
CNY 10170.00 |
|
VC100794 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 1], codon optimized for human cell expression, NP_044608 |
CNY 3800.00 |
|
VC100795 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044609 |
CNY 6040.00 |
|
VC100796 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 1], codon optimized for human cell expression, NP_044610 |
CNY 12920.00 |
|
VC100797 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 1], codon optimized for human cell expression, NP_044611 |
CNY 5800.00 |
|
VC100798 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044612 |
CNY 3800.00 |
|
VC100799 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 1], codon optimized for human cell expression, NP_044613 |
CNY 7510.00 |
|
VC100800 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 1], codon optimized for human cell expression, NP_044614 |
CNY 5784.00 |
|
VC100801 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 1], codon optimized for human cell expression, NP_044615 |
CNY 3600.00 |
|
VC100802 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 1], codon optimized for human cell expression, NP_044616 |
CNY 11020.00 |
|
VC100803 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 1], codon optimized for human cell expression, NP_044617 |
CNY 4470.00 |
|
VC100805 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044619 |
CNY 3800.00 |
|
VC100806 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044620 |
CNY 20710.00 |
|
VC100807 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL20 [Human herpesvirus 1], codon optimized for human cell expression, NP_044621 |
CNY 3800.00 |
|
VC100808 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL21 [Human herpesvirus 1], codon optimized for human cell expression, NP_044622 |
CNY 6460.00 |
|
VC100809 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 1], codon optimized for human cell expression, NP_044623 |
CNY 12730.00 |
|
VC100810 | Myc-DDK-tagged ORF clone of viral ORF for thymidine kinase [Human herpesvirus 1], codon optimized for human cell expression, NP_044624 |
CNY 4024.00 |
|
VC100811 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 1], codon optimized for human cell expression, NP_044625 |
CNY 2640.00 |
|
VC100812 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 1], codon optimized for human cell expression, NP_044626 |
CNY 7030.00 |
|
VC100814 | Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044628 |
CNY 3800.00 |
|
VC100815 | Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044629 |
CNY 13680.00 |
|
VC100816 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044630 |
CNY 11970.00 |
|
VC100817 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044631 |
CNY 9160.00 |
|
VC100818 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044632. Note: ORF is codon optimized |
CNY 9456.00 |
|
VC100819 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044633 |
CNY 3800.00 |
|
VC100820 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 1], codon optimized for human cell expression, NP_044634 |
CNY 7220.00 |
|
VC100821 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 1], codon optimized for human cell expression, NP_044635 |
CNY 3800.00 |
|
VC100822 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044636 |
CNY 3800.00 |
|
VC100823 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044637 |
CNY 3800.00 |
|
VC100825 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 1], codon optimized for human cell expression, NP_044639 |
CNY 16910.00 |
|
VC100826 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 1], codon optimized for human cell expression, NP_044640 |
CNY 5700.00 |
|
VC100828 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044642 |
CNY 4090.00 |
|
VC100829 | Myc-DDK-tagged ORF clone of viral ORF for tegument host shutoff protein [Human herpesvirus 1], codon optimized for human cell expression, NP_044643 |
CNY 3656.00 |
|
VC100830 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044644. Note: ORF is codon optimized |
CNY 3656.00 |
|
VC100832 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein C [Human herpesvirus 1], codon optimized for human cell expression, NP_044646 |
CNY 6180.00 |
|
VC100833 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL45 [Human herpesvirus 1], codon optimized for human cell expression, NP_044647 |
CNY 3800.00 |
|
VC100834 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP11/12 [Human herpesvirus 1], codon optimized for human cell expression, NP_044648 |
CNY 10830.00 |
|
VC100836 | Myc-DDK-tagged ORF clone of viral ORF for transactivating tegument protein VP16 [Human herpesvirus 1], codon optimized for human cell expression, NP_044650 |
CNY 3656.00 |
|
VC100838 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 1], codon optimized for human cell expression, NP_044652 |
CNY 3800.00 |
|
VC100839 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 1], codon optimized for human cell expression, NP_044653 |
CNY 4470.00 |
|
VC100840 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 1], codon optimized for human cell expression, NP_044654 |
CNY 2400.00 |
|
VC100841 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 1], codon optimized for human cell expression, NP_044655 |
CNY 8104.00 |
|
VC100842 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein K [Human herpesvirus 1], codon optimized for human cell expression, NP_044656 |
CNY 4090.00 |
|
VC100844 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL55 [Human herpesvirus 1], codon optimized for human cell expression, NP_044658 |
CNY 3800.00 |
|
VC100845 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL56 [Human herpesvirus 1], codon optimized for human cell expression, NP_044659 |
CNY 3800.00 |
|
VC100849 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 1], codon optimized for human cell expression, NP_044663 |
CNY 5130.00 |
|
VC100850 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US2 [Human herpesvirus 1], codon optimized for human cell expression, NP_044664 |
CNY 3800.00 |
|
VC100851 | Myc-DDK-tagged ORF clone of viral ORF for serine/threonine protein kinase US3 [Human herpesvirus 1], codon optimized for human cell expression, NP_044665 |
CNY 5488.00 |
|
VC100852 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein G [Human herpesvirus 1], codon optimized for human cell expression, NP_044666 |
CNY 3800.00 |
|
VC100853 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein J [Human herpesvirus 1], codon optimized for human cell expression, NP_044667 |
CNY 3800.00 |
|
VC100854 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein D [Human herpesvirus 1], codon optimized for human cell expression, NP_044668 |
CNY 4660.00 |
|
VC100855 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein I [Human herpesvirus 1], codon optimized for human cell expression, NP_044669 |
CNY 4660.00 |
|
VC100856 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein E [Human herpesvirus 1], codon optimized for human cell expression, NP_044670 |
CNY 6650.00 |
|
VC100857 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US8A [Human herpesvirus 1], codon optimized for human cell expression, NP_044671 |
CNY 3800.00 |
|
VC100858 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US9 [Human herpesvirus 1], codon optimized for human cell expression, NP_044672 |
CNY 3800.00 |
|
VC100859 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 1], codon optimized for human cell expression, NP_044673 |
CNY 3800.00 |
|
VC100861 | Myc-DDK-tagged ORF clone of viral ORF for TAP transporter inhibitor ICP47 [Human herpesvirus 1], codon optimized for human cell expression, NP_044675 |
CNY 1920.00 |