HCoV-HKU1 nsp9 Gene Tagged ORF Clone
CAT#: VC100583
- TrueORF®
Myc-DDK-tagged ORF clone for nsp9 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459943
View other clones from "HCoV-HKU1" (18)
Need custom modification / cloning service?
Get a free quote
CNY 3800.00
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100583 represents NCBI reference of YP_459943 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAATAACGAACTGATGCCACACAAGCTTAAGATACAAGTTGTTAATTCCGGCTCAGATATGAATTGTA ACATCCCCACCCAGTGTTATTATAACAACGGCTCTAGTGGGCGCATCGTGTACGCCGTGCTCTCCGACGT GGATGGCTTGAAATACACAAAAATAATGAAGGACGATGGGAACTGTGTGGTGCTCGAGCTCGATCCACCC TGTAAGTTTTCCATCCAGGATGTTAAGGGCTTGAAGATTAAGTACCTCTATTTCATTAAGGGCTGCAACA CTCTTGCCAGAGGATGGGTAGTCGGCACACTTTCATCTACAATCCGACTGCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100583 representing YP_459943
Red=Cloning sites Green=Tags MNNELMPHKLKIQVVNSGSDMNCNIPTQCYYNNGSSGRIVYAVLSDVDGLKYTKIMKDDGNCVVLELDPP CKFSIQDVKGLKIKYLYFIKGCNTLARGWVVGTLSSTIRLQ TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_006577 |
ORF Size | 333 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_006577.2, YP_459943 |
RefSeq ORF | 333 bp |
MW | 12.4 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100570 | Myc-DDK-tagged ORF clone for hemagglutinin-esterase glycoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173237 |
CNY 3656.00 |
|
VC100572 | Myc-DDK-tagged ORF clone for non-structural protein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173239 |
CNY 3800.00 |
|
VC100573 | Myc-DDK-tagged ORF clone for small membrane protein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173240 |
CNY 3800.00 |
|
VC100574 | Myc-DDK-tagged ORF clone for membrane glycoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173241 |
CNY 2400.00 |
|
VC100575 | Myc-DDK-tagged ORF clone for nucleocapsid phosphoprotein [Human coronavirus HKU1], codon optimized for human cell expression, YP_173242 |
CNY 5488.00 |
|
VC100576 | Myc-DDK-tagged ORF clone for nucleocapsid phosphoprotein 2 [Human coronavirus HKU1], codon optimized for human cell expression, YP_173243 |
CNY 3800.00 |
|
VC100577 | Myc-DDK-tagged ORF clone for nsp1 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460018 |
CNY 3800.00 |
|
VC100578 | Myc-DDK-tagged ORF clone for nsp2 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459934 |
CNY 7030.00 |
|
VC100579 | Myc-DDK-tagged ORF clone for nsp6 (hydrophobic domain) [Human coronavirus HKU1], codon optimized for human cell expression, YP_460019 |
CNY 3800.00 |
|
VC100580 | Myc-DDK-tagged ORF clone for nsp5 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459936 |
CNY 3800.00 |
|
VC100581 | Myc-DDK-tagged ORF clone for nsp7 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459938 |
CNY 3800.00 |
|
VC100582 | Myc-DDK-tagged ORF clone for nsp8 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460020 |
CNY 3800.00 |
|
VC100584 | Myc-DDK-tagged ORF clone for nsp10 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459939 |
CNY 3800.00 |
|
VC100585 | Myc-DDK-tagged ORF clone for nsp13 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459942 |
CNY 7220.00 |
|
VC100586 | Myc-DDK-tagged ORF clone for nsp14 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460021 |
CNY 6370.00 |
|
VC100587 | Myc-DDK-tagged ORF clone for nsp15 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460022 |
CNY 4470.00 |
|
VC100588 | Myc-DDK-tagged ORF clone for nsp16 [Human coronavirus HKU1], codon optimized for human cell expression, YP_460023 |
CNY 3800.00 |
|
VC100591 | Myc-DDK-tagged ORF clone for nsp4 [Human coronavirus HKU1], codon optimized for human cell expression, YP_459935 |
CNY 6080.00 |