E3 (NC_003266) Virus Tagged ORF Clone
CAT#: VC100488
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-alpha [Human adenovirus E], codon optimized for human cell expression, YP_068044
View other clones from "Virus" (37)
Need custom modification / cloning service?
Get a free quote
CNY 3800.00
Product images

CNY 600.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100488 represents NCBI reference of YP_068044 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATCCCCAGGCAGTTCTTCATAATCGGGCTGCTCTGCGCCCTGCAGGTATGCGCCACGTTGGCTCTGG TGGCCAACGCCTCCCCTGATTGCATTGGACCTTTCGCCTCTTATGTGCTGTTTGCATTCATCACTTGCAT CTGTTGTTGTTCAATTGTGTGCCTGCTCATTACATTCTTCCAATTCGTCGACTGGGTGTTTGTCAGGATA GCCTATCTCAGACATCATCCCCAATACAGGGATCAGCGGGTTGCACAACTCCTTAGACTGATC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100488 representing YP_068044
Red=Cloning sites Green=Tags MIPRQFFIIGLLCALQVCATLALVANASPDCIGPFASYVLFAFITCICCCSIVCLLITFFQFVDWVFVRI AYLRHHPQYRDQRVAQLLRLI TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_003266 |
ORF Size | 273 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_003266.2, YP_068044 |
RefSeq ORF | 273 bp |
Locus ID | 2958477 |
MW | 10.4 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100462 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1A [Human adenovirus E], codon optimized for human cell expression, YP_068018 |
CNY 3800.00 |
|
VC100463 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 19K [Human adenovirus E], codon optimized for human cell expression, YP_068019 |
CNY 3800.00 |
|
VC100464 | Myc-DDK-tagged ORF clone of viral ORF for control protein E1B 55K [Human adenovirus E], codon optimized for human cell expression, YP_068020 |
CNY 5890.00 |
|
VC100465 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein IX [Human adenovirus E], codon optimized for human cell expression, YP_068021 |
CNY 3800.00 |
|
VC100466 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein IVa2 [Human adenovirus E], codon optimized for human cell expression, YP_068022 |
CNY 5510.00 |
|
VC100467 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase [Human adenovirus E], codon optimized for human cell expression, YP_068023 |
CNY 18050.00 |
|
VC100468 | Myc-DDK-tagged ORF clone of viral ORF for terminal protein precursor pTP [Human adenovirus E], codon optimized for human cell expression, YP_068024 |
CNY 7700.00 |
|
VC100469 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 52K [Human adenovirus E], codon optimized for human cell expression, YP_068025 |
CNY 4660.00 |
|
VC100470 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pIIIa [Human adenovirus E], codon optimized for human cell expression, YP_068026 |
CNY 7130.00 |
|
VC100471 | Myc-DDK-tagged ORF clone of viral ORF for penton base [Human adenovirus E], codon optimized for human cell expression, YP_068027 |
CNY 6460.00 |
|
VC100472 | Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pVII [Human adenovirus E], codon optimized for human cell expression, YP_068028 |
CNY 3800.00 |
|
VC100473 | Myc-DDK-tagged ORF clone of viral ORF for core protein V [Human adenovirus E], codon optimized for human cell expression, YP_068029 |
CNY 4090.00 |
|
VC100474 | Myc-DDK-tagged ORF clone of viral ORF for core protein precursor pX [Human adenovirus E], codon optimized for human cell expression, YP_068030 |
CNY 3800.00 |
|
VC100475 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVI [Human adenovirus E], codon optimized for human cell expression, YP_068031 |
CNY 3800.00 |
|
VC100476 | Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus E], codon optimized for human cell expression, YP_068032 |
CNY 14060.00 |
|
VC100477 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus E], codon optimized for human cell expression, YP_068033 |
CNY 3800.00 |
|
VC100478 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human adenovirus E], codon optimized for human cell expression, YP_068034 |
CNY 6180.00 |
|
VC100479 | Myc-DDK-tagged ORF clone of viral ORF for hexon assembly protein 100K [Human adenovirus E], codon optimized for human cell expression, YP_068035 |
CNY 12070.00 |
|
VC100480 | Myc-DDK-tagged ORF clone of viral ORF for protein 33K [Human adenovirus E], codon optimized for human cell expression, YP_068036 |
CNY 3800.00 |
|
VC100481 | Myc-DDK-tagged ORF clone of viral ORF for encapsidation protein 22K [Human adenovirus E], codon optimized for human cell expression, YP_068037 |
CNY 3800.00 |
|
VC100482 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein precursor pVIII [Human adenovirus E], codon optimized for human cell expression, YP_068038 |
CNY 3800.00 |
|
VC100483 | Myc-DDK-tagged ORF clone of viral ORF for control protein E3 125K [Human adenovirus E], codon optimized for human cell expression, YP_068039 |
CNY 3800.00 |
|
VC100484 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-alpha [Human adenovirus E], codon optimized for human cell expression, YP_068040 |
CNY 3800.00 |
|
VC100485 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 gp19K [Human adenovirus E], codon optimized for human cell expression, YP_068041 |
CNY 3800.00 |
|
VC100486 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-beta [Human adenovirus E], codon optimized for human cell expression, YP_068042 |
CNY 3800.00 |
|
VC100487 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein E3 CR1-delta [Human adenovirus E], codon optimized for human cell expression, YP_068043 |
CNY 3800.00 |
|
VC100489 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein E3 RID-beta [Human adenovirus E], codon optimized for human cell expression, YP_068045 |
CNY 3800.00 |
|
VC100490 | Myc-DDK-tagged ORF clone of viral ORF for control protein E3 147K [Human adenovirus E], codon optimized for human cell expression, YP_068046 |
CNY 3800.00 |
|
VC100491 | Myc-DDK-tagged ORF clone of viral ORF for protein U, partial [Human adenovirus E], codon optimized for human cell expression, YP_068047 |
CNY 3800.00 |
|
VC100492 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus E], codon optimized for human cell expression, YP_068048 |
CNY 5230.00 |
|
VC100493 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf6/7 [Human adenovirus E], codon optimized for human cell expression, YP_068049 |
CNY 3800.00 |
|
VC100494 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4 34K [Human adenovirus E], codon optimized for human cell expression, YP_068050 |
CNY 3800.00 |
|
VC100495 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf4 [Human adenovirus E], codon optimized for human cell expression, YP_068051 |
CNY 3800.00 |
|
VC100496 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf3 [Human adenovirus E], codon optimized for human cell expression, YP_068052 |
CNY 3800.00 |
|
VC100497 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf2 [Human adenovirus E], codon optimized for human cell expression, YP_068053 |
CNY 3800.00 |
|
VC100498 | Myc-DDK-tagged ORF clone of viral ORF for control protein E4orf1 [Human adenovirus E], codon optimized for human cell expression, YP_068054 |
CNY 3800.00 |
|
VC100499 | Myc-DDK-tagged ORF clone of viral ORF for protein 136K [Human adenovirus E], codon optimized for human cell expression, YP_001661328 |
CNY 3800.00 |