BANF1 (NM_003860) Human Tagged ORF Clone
CAT#: RG203270
- TrueORF®
BANF1 (tGFP-tagged) - Human barrier to autointegration factor 1 (BANF1), transcript variant 1
ORF Plasmid: DDK
"NM_003860" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,800.00
CNY 4,370.00
Cited in 1 publication. |
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | BAF; BCRP1; D14S1460; NGPS |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG203270 representing NM_003860
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAACCTCCCAAAAGCACCGAGACTTCGTGGCAGAGCCCATGGGGGAGAAGCCAGTGGGGAGCCTGG CTGGGATTGGTGAAGTCCTGGGCAAGAAGCTGGAGGAAAGGGGTTTTGACAAGGCCTATGTTGTCCTTGG CCAGTTTCTGGTGCTAAAGAAAGATGAAGACCTCTTCCGGGAATGGCTGAAAGACACTTGTGGCGCCAAC GCCAAGCAGTCCCGGGACTGCTTCGGATGCCTTCGAGAGTGGTGCGACGCCTTCTTG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG203270 representing NM_003860
Red=Cloning site Green=Tags(s) MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN AKQSRDCFGCLREWCDAFL TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003860 |
ORF Size | 267 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003860.4 |
RefSeq Size | 1192 bp |
RefSeq ORF | 270 bp |
Locus ID | 8815 |
UniProt ID | O75531 |
Gene Summary | The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Jan 2009] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Dephosphorylation of barrier-to-autointegration-factor by protein phosphatase 4 and its role in cell mitosis
,Zhuang, X;Semenova, E;Maric, D;Craigie, R;,
J. Biol. Chem.
,PubMed ID 24265311
[BANF1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203270 | BANF1 (Myc-DDK-tagged)-Human barrier to autointegration factor 1 (BANF1), transcript variant 1 |
CNY 1,200.00 |
|
RC203270L1 | Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC203270L2 | Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC203270L3 | Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC203270L4 | Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
SC117722 | BANF1 (untagged)-Human barrier to autointegration factor 1 (BANF1), transcript variant 1 |
CNY 1,200.00 |