HGF (NM_001010934) Human Tagged ORF Clone
CAT#: RC220421
- TrueORF®
HGF (Myc-DDK-tagged)-Human hepatocyte growth factor (hepapoietin A, scatter factor) (HGF), transcript variant 5
ORF Plasmid: tGFP
"NM_001010934" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3990.00
CNY 300.00
CNY 6840.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DFNB39; F-TCF; HGFB; HPTA; SF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC220421 representing NM_001010934
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGGGTGACCAAACTCCTGCCAGCCCTGCTGCTGCAGCATGTCCTCCTGCATCTCCTCCTGCTCCCCA TCGCCATCCCCTATGCAGAGGGACAAAGGAAAAGAAGAAATACAATTCATGAATTCAAAAAATCAGCAAA GACTACCCTAATCAAAATAGATCCAGCACTGAAGATAAAAACCAAAAAAGTGAATACTGCAGACCAATGT GCTAATAGATGTACTAGGAATAAAGGACTTCCATTCACTTGCAAGGCTTTTGTTTTTGATAAAGCAAGAA AACAATGCCTCTGGTTCCCCTTCAATAGCATGTCAAGTGGAGTGAAAAAAGAATTTGGCCATGAATTTGA CCTCTATGAAAACAAAGACTACATTAGAAACTGCATCATTGGTAAAGGACGCAGCTACAAGGGAACAGTA TCTATCACTAAGAGTGGCATCAAATGTCAGCCCTGGAGTTCCATGATACCACACGAACACAGCTTTTTGC CTTCGAGCTATCGGGGTAAAGACCTACAGGAAAACTACTGTCGAAATCCTCGAGGGGAAGAAGGGGGACC CTGGTGTTTCACAAGCAATCCAGAGGTACGCTACGAAGTCTGTGACATTCCTCAGTGTTCAGAAGGTAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC220421 representing NM_001010934
Red=Cloning site Green=Tags(s) MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQC ANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTV SITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEGK myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NM_001010934 |
ORF Size | 630 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_001010934.3 |
RefSeq Size | 2079 bp |
RefSeq ORF | 633 bp |
Locus ID | 3082 |
UniProt ID | P14210 |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Protease, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Melanoma, Pathways in cancer, Renal cell carcinoma |
MW | 24.12 kDa |
Gene Summary | This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC220421L3 | Lenti-ORF clone of HGF (Myc-DDK-tagged)-Human hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 5 |
CNY 5890.00 |
|
RC220421L4 | Lenti-ORF clone of HGF (mGFP-tagged)-Human hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 5 |
CNY 5890.00 |
|
RG220421 | HGF (tGFP-tagged) - Human hepatocyte growth factor (hepapoietin A; scatter factor) (HGF), transcript variant 5 |
CNY 5440.00 |
|
SC301541 | HGF (untagged)-Human hepatocyte growth factor (hepapoietin A, scatter factor) (HGF), transcript variant 5 |
CNY 3600.00 |