H4C6 (NM_003540) Human Tagged ORF Clone
CAT#: RC215318
HIST1H4F (Myc-DDK-tagged)-Human histone cluster 1, H4f (HIST1H4F)
ORF Plasmid: tGFP
"NM_003540" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1200.00
CNY 3705.00
CNY 300.00
CNY 6840.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | H4; H4-16; H4/c; H4C1; H4C2; H4C3; H4C4; H4C5; H4C8; H4C9; H4C11; H4C12; H4C13; H4C14; H4C15; H4FC; HIST1H4F |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC215318 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTGGTAGAGGCAAAGGTGGTAAAGGTTTAGGAAAGGGAGGCGCCAAGCGCCATCGCAAAGTGCTGC GTGACAACATACAGGGCATCACGAAGCCCGCCATCCGTCGCTTGGCCCGACGCGGCGGCGTGAAACGCAT TTCGGGCCTCATTTATGAGGAGACCCGCGGTGTTCTTAAGGTGTTCCTGGAGAATGTGATACGGGACGCC GTAACCTACACGGAGCACGCCAAGCGTAAGACAGTCACTGCAATGGATGTTGTCTACGCGCTCAAGCGCC AGGGACGCACTCTGTACGGCTTTGGTGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC215318 protein sequence
Red=Cloning site Green=Tags(s) MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NM_003540 |
ORF Size | 309 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_003540.4 |
RefSeq Size | 368 bp |
RefSeq ORF | 312 bp |
Locus ID | 8361 |
UniProt ID | P62805 |
Domains | H4, histone |
Protein Pathways | Systemic lupus erythematosus |
MW | 11.4 kDa |
Gene Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Aug 2015] |
Shipping | Ambient |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC215318L3 | Lenti ORF clone of Human histone cluster 1, H4f (HIST1H4F), Myc-DDK-tagged |
CNY 5890.00 |
|
RC215318L4 | Lenti ORF clone of Human histone cluster 1, H4f (HIST1H4F), mGFP tagged |
CNY 5890.00 |
|
RG215318 | HIST1H4F (tGFP-tagged) - Human histone cluster 1, H4f (HIST1H4F) |
CNY 2800.00 |
|
SC303335 | HIST1H4F (untagged)-Human histone cluster 1, H4f (HIST1H4F) |
CNY 3990.00 |