Caspase 3 (CASP3) (NM_032991) Human Tagged ORF Clone
CAT#: RC204444
- TrueORF®
CASP3 (Myc-DDK-tagged)-Human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta
ORF Plasmid: tGFP
"NM_032991" in other vectors (7)
Need custom modification / cloning service?
Get a free quote
CNY 3600.00
Cited in 1 publication. |
CNY 300.00
CNY 6840.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CPP32; CPP32B; SCA-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204444 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGAACACTGAAAACTCAGTGGATTCAAAATCCATTAAAAATTTGGAACCAAAGATCATACATGGAA GCGAATCAATGGACTCTGGAATATCCCTGGACAACAGTTATAAAATGGATTATCCTGAGATGGGTTTATG TATAATAATTAATAATAAGAATTTTCATAAAAGCACTGGAATGACATCTCGGTCTGGTACAGATGTCGAT GCAGCAAACCTCAGGGAAACATTCAGAAACTTGAAATATGAAGTCAGGAATAAAAATGATCTTACACGTG AAGAAATTGTGGAATTGATGCGTGATGTTTCTAAAGAAGATCACAGCAAAAGGAGCAGTTTTGTTTGTGT GCTTCTGAGCCATGGTGAAGAAGGAATAATTTTTGGAACAAATGGACCTGTTGACCTGAAAAAAATAACA AACTTTTTCAGAGGGGATCGTTGTAGAAGTCTAACTGGAAAACCCAAACTTTTCATTATTCAGGCCTGCC GTGGTACAGAACTGGACTGTGGCATTGAGACAGACAGTGGTGTTGATGATGACATGGCGTGTCATAAAAT ACCAGTGGAGGCCGACTTCTTGTATGCATACTCCACAGCACCTGGTTATTATTCTTGGCGAAATTCAAAG GATGGCTCCTGGTTCATCCAGTCGCTTTGTGCCATGCTGAAACAGTATGCCGACAAGCTTGAATTTATGC ACATTCTTACCCGGGTTAACCGAAAGGTGGCAACAGAATTTGAGTCCTTTTCCTTTGACGCTACTTTTCA TGCAAAGAAACAGATTCCATGTATTGTTTCCATGCTCACAAAAGAACTCTATTTTTATCAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204444 protein sequence
Red=Cloning site Green=Tags(s) MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NM_032991 |
ORF Size | 831 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_032991.2, NP_116786.1 |
RefSeq Size | 2522 bp |
RefSeq ORF | 834 bp |
Locus ID | 836 |
UniProt ID | P42574 |
Domains | CASc, ICE_p10, ICE_p20 |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protease |
Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, Huntington's disease, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Parkinson's disease, Pathways in cancer, Viral myocarditis |
MW | 31.6 kDa |
Gene Summary | The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. [provided by RefSeq, Aug 2017] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Gamma secretase Activating Protein is a Substrate for Caspase-3: Implications for Alzheimer's Disease
,Chu, J;Li, JG;Joshi, YB;Giannopoulos, PF;,
Biological Psychiatry
[CASP3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204444L1 | Lenti ORF clone of Human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta, Myc-DDK-tagged |
CNY 6000.00 |
|
RC204444L2 | Lenti ORF clone of Human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta, mGFP tagged |
CNY 5890.00 |
|
RC204444L3 | Lenti ORF clone of Human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta, Myc-DDK-tagged |
CNY 5890.00 |
|
RC204444L4 | Lenti ORF clone of Human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta, mGFP tagged |
CNY 6000.00 |
|
RG204444 | CASP3 (tGFP-tagged) - Human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta |
CNY 5200.00 |
|
SC101958 | CASP3 (untagged)-Human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta |
CNY 3600.00 |
|
SC322483 | CASP3 (untagged)-Human caspase 3, apoptosis-related cysteine peptidase (CASP3), transcript variant beta |
CNY 3600.00 |
其它Caspase 3产品