Pym1 (NM_001253704) Mouse Tagged ORF Clone
CAT#: MR227702
- TrueORF®
Wibg (myc-DDK-tagged) - Mouse within bgcn homolog (Drosophila) (Wibg), transcript variant 3
"NM_001253704" in other vectors (1)
Need custom modification / cloning service?
Get a free quote
CNY 1,900.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | A030010B05Rik; Pym; Wibg |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR227702 representing NM_001253704
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGACTCCCTATGTAACTGACGAGACCGGCGCTACACCTCAGGATTACTACAACCTGGACTTCATCT GTGACACATTTCCTTTCAGGCAAGTACATTGCCTCAACACAGAGACCCGACGGGACGTGGCGAAAGCAGC GGAGGGTCAAAGAAGGATACGTGCCCCAAGAGGAGGTCCCAGTCTA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR227702 representing NM_001253704
Red=Cloning site Green=Tags(s) MATPYVTDETGATPQDYYNLDFICDTFPFRQVHCLNTETRRDVAKAAEGQRRIRAPRGGPSL myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001253704 |
ORF Size | 186 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001253704.1, NP_001240633.1 |
RefSeq Size | 1220 bp |
RefSeq ORF | 189 bp |
Locus ID | 78428 |
MW | 7.5 kDa |
Gene Summary | Key regulator of the exon junction complex (EJC), a multiprotein complex that associates immediately upstream of the exon-exon junction on mRNAs and serves as a positional landmark for the intron exon structure of genes and directs post-transcriptional processes in the cytoplasm such as mRNA export, nonsense-mediated mRNA decay (NMD) or translation. Acts as an EJC disassembly factor, allowing translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its association with the 40S ribosomal subunit probably prevents a translation-independent disassembly of the EJC from spliced mRNAs, by restricting its activity to mRNAs that have been translated. Interferes with NMD and enhances translation of spliced mRNAs, probably by antagonizing EJC functions (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC225491 | Wibg (untagged) - Mouse within bgcn homolog (Drosophila) (Wibg), transcript variant 3 |
CNY 2,000.00 |