Exosc7 (BC052656) Mouse Tagged ORF Clone

CAT#: MR203992

  • TrueORF®

Exosc7 (Myc-DDK-tagged) - Mouse exosome component 7 (cDNA clone MGC:60453 IMAGE:30041585)

ORF Plasmid: DDK tGFP



  "BC052656" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2400.00

CNY 6365.00


货期*
现货

规格
    • 10 ug

Product images

推荐一起购买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
    • 5 ml

CNY 6840.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2610002K22Rik; AV212732; mKIAA0116
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203992 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCGGTGGCGCTAAGCGAGGCCGAGAAGGTCTACATCGTTCATGGAGTGCAGGAAGACCTTCGGG
TGGATGGCCGTGGCTGTGAGGACTACCGATGTGTTGAAGTAGAGACTGATGTGGTGTCTAACACCAGTGG
GTCTGCCAGAGTCAAGCTGGGTCACACAGACATCTTGGTGGGAGTGAAAGCAGAAATGGGGACACCGAAG
CTGGAGAAACCGAATGAAGGCTACCTGGAGTTCTTTGTTGACTGTTCAGCCAATGCTACCCCAGAATTCG
AAGGGCGAGGAGGTGATGACCTTGGCACAGAGATTGCTAACACCCTCTACCGGATATTTAACAACAAGAG
CAGCGTAGACCTGAGGTCCCTCTGCATCAGTCCTCGAGAGCACTGCTGGGTTCTATATGTGGATGTGCTG
CTGCTGGAATGTGGTGGGAATTTGTTTGATGCTATTTCCATTGCTGTAAAAGCTGCTCTCTTCGACACAA
GGATACCAAGGGTTCGTGTTCTGGAGGATGAAGAGGGGGCAAAGGACATTGAGCTGTCTGACGATCCTTA
TGACTGCATCCGACTGAGTGTAGAGAATGTCCCCTGCATTGTCACCCTGTGCAAGATTGGCTGCCGGCAT
GTGGTAGATGCCACACTCCAAGAGGAGGCCTGTTCCCTGGCCAGCTTGCTGGTGTCAGTGACCAGCAAGG
GAGTAGTGACATGCATGAGGAAAGTGGGGAAAGGAAGCCTGGATCCTGAGAGCATCTTCGAGATGATGGA
GAGCAGCAAGCGAGTGGGCAAGGTGCTGCACGTGTCCTTGCAGAGCCTTCTGCACAAGGAAGAAAGCCTG
GGGCCCAAGAGGCCGAGAGTCGGGTTCCTGGGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203992 protein sequence
Red=Cloning site Green=Tags(s)

MASVALSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPK
LEKPNEGYLEFFVDCSANATPEFEGRGGDDLGTEIANTLYRIFNNKSSVDLRSLCISPREHCWVLYVDVL
LLECGGNLFDAISIAVKAALFDTRIPRVRVLEDEEGAKDIELSDDPYDCIRLSVENVPCIVTLCKIGCRH
VVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMESSKRVGKVLHVSLQSLLHKEESL
GPKRPRVGFLG

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN BC052656
ORF Size 873 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC052656, AAH52656
RefSeq Size 1030 bp
RefSeq ORF 875 bp
Locus ID 66446
MW 31.8 kDa
Gene Summary Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...