Cbr1 (NM_007620) Mouse Tagged ORF Clone

CAT#: MR203724

  • TrueORF®

Cbr1 (Myc-DDK-tagged) - Mouse carbonyl reductase 1 (Cbr1)

ORF Plasmid: DDK tGFP



  "NM_007620" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,600.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AW261796; Cbr; CR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203724 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCCAGCAGACCCGTGGCGCTGGTGACCGGTGCTAACAAAGGAATCGGATTCGCGATCACTCGTG
ACCTGTGTCGGAAATTCTCCGGGGACGTGGTGCTCGCGGCGCGGGACGAGGAGCGGGGCCAAACGGCAGT
GCAAAAGCTGCAGGCGGAGGGCCTGAGCCCACGCTTCCACCAGCTGGACATCGACAACCCGCAGAGCATT
CGCGCACTGCGCGACTTTCTGCTCAAGGAATACGGAGGCCTGGACGTGCTGGTCAACAACGCAGGCATCG
CCTTCAAGGTCAATGACGACACCCCCTTCCACATTCAAGCAGAGGTGACAATGAAAACGAACTTTTTTGG
TACCCGAGATGTCTGCAAGGAGCTGCTCCCTCTAATAAAACCCCAAGGCAGAGTGGTGAATGTGTCCAGC
ATGGTGAGTCTCAGGGCCCTGAAAAACTGCAGGCTGGAGCTGCAGCAGAAGTTTCGAAGCGAGACCATCA
CAGAGGAGGAGCTGGTGGGGCTCATGAACAAGTTTGTGGAAGATACAAAGAAAGGAGTCCATGCGGAAGA
AGGTTGGCCTAATAGTGCATATGGGGTCACCAAGATTGGGGTGACAGTCCTGTCCAGAATCCTTGCCAGG
AAACTCAATGAGCAGAGGAGAGGGGACAAGATCCTTCTGAATGCCTGCTGCCCTGGGTGGGTCAGAACCG
ACATGGCAGGACCAAAAGCCACCAAAAGCCCAGAAGAAGGAGCAGAGACCCCTGTGTACTTGGCCCTTTT
GCCTCCAGATGCAGAGGGGCCTCATGGGCAGTTTGTTCAAGATAAAAAAGTTGAACCATGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203724 protein sequence
Red=Cloning site Green=Tags(s)

MSSSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGLSPRFHQLDIDNPQSI
RALRDFLLKEYGGLDVLVNNAGIAFKVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQGRVVNVSS
MVSLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPNSAYGVTKIGVTVLSRILAR
KLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVQDKKVEPW

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007620
ORF Size 834 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007620.1, NM_007620.2, NP_031646.2
RefSeq Size 1081 bp
RefSeq ORF 834 bp
Locus ID 12408
UniProt ID P48758
MW 30.6 kDa
Gene Summary NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...