Lin7a (BC105965) Mouse Tagged ORF Clone

CAT#: MR202694

  • TrueORF®

Lin7a (Myc-DDK-tagged) - Mouse lin-7 homolog A (C. elegans) (cDNA clone MGC:102231 IMAGE:30620416)

ORF Plasmid: DDK tGFP



  "BC105965" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2280.00


货期*
4周

规格
    • 10 ug

Cited in 1 publication.

Product images

推荐一起购买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
    • 5 ml

CNY 6840.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms Veli1, LIN-7A, MALS-1, TIP-33, Veli
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202694 representing BC105965
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATGAAACGATTACTGTTAATGGCTGCCCTGAATTCCGTGCGAGGGCCACAGCAAAGGCAACAGTTG
CAGCTTTTGCAGCCAGCGAAGGCCACTCCCACCCTCGGGTAGTTGAACTGCCAAAGACTGATGAAGGCCT
GGGTTTTAATGTGATGGGAGGGAAGGAACAGAATTCCCCGATTTACATCTCCCGCATCATCCCTGGAGGG
GTGGCTGAAAGACATGGAGGCCTCAAAAGAGGGGACCAGCTGCTATCAGTGAACGGAGTGAGTGTGGAAG
GGGAGCACCATGAGAAAGCTGTGGAACTTCTCAAGGCTGCAAAGGCAACAGTTGCAGCTTTTGCAGCCAG
CGAAGGCCACTCCCACCCTCGGGTAGTTGAACTGCCAAAGACTGATGAAGGCCTGGGTTTTAATGTGATG
GGAGGGAAGGAACAGAATTCCCCGATTTACATCTCCCGCATCATCCCTGGAGGGGTGGCTGAAAGACATG
GAGGCCTCAAAAGAGGGGACCAGCTGCTATCAGATACACCCCAAAAGTCCTGGAAGAGATGGAGGCTCGT
TTCGAGAAGCTGCGGACAGCTCGGCGTCGACAGCAGCAGCAGTTGCTCATTCAGCAGCAGCAACAGCAGC
AGCAACAACAACCACAACAAAACCACATGTCATAGGCGCTCGAAGGAAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202694 representing BC105965
Red=Cloning site Green=Tags(s)

MHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGG
VAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVM
GGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSDTPQKSWKRWRLVSRSCGQLGVDSSSSCSFSSSNSS
SNNNHNKTTCHRRSKES

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC105965
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC105965
RefSeq Size 5500 bp
RefSeq ORF 683 bp
Locus ID 108030
MW 201.6 kDa
Gene Summary Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...