Hmgb2 (BC002050) Mouse Tagged ORF Clone
CAT#: MR202276
- TrueORF®
Hmgb2 (Myc-DDK-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780)
ORF Plasmid: tGFP
"BC002050" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 2400.00
CNY 2945.00
Cited in 1 publication. |
CNY 300.00
CNY 6840.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C80539; HMG-2; Hmg2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR202276 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGCAAGGGTGACCCCAACAAGCCGCGGGGCAAAATGTCCTCGTACGCCTTCTTCGTGCAGACCTGCC GCGAGGAGCACAAGAAGAAGCATCCCGACTCGTCGGTGAACTTCGCCGAGTTCTCCAAGAAATGCTCCGA GAGATGGAAGACCATGTCTGCAAAGGAAAAGTCCAAGTTTGAAGATTTGGCCAAGAGCGACAAAGCTCGT TATGACAGGGAGATGAAGAACTATGTTCCTCCCAAAGGGGATAAGAAAGGAAAGAAAAAAGACCCCAATG CTCCGAAGAGACCACCGTCTGCCTTCTTCCTGTTTTGCTCTGAAAATCGCCCAAAGATCAAAATTGAACA CCCAGGCCTGTCTATTGGAGATACTGCGAAGAAACTGGGTGAGATGTGGTCTGAGCAATCTGCCAAAGAT AAACAACCGTATGAGCAGAAAGCAGCTAAACTAAAGGAGAAGTATGAAAAGGATATTGCTGCATACCGTG CCAAGGGCAAAAGTGAAGCAGGAAAGAAGGGTCCTGGTAGGCCAACAGGCTCAAAGAAGAAGAACGAACC AGAAGATGAGGAGGAGGAAGAAGAGGAGGAAGAGGAGGAAGATGAAGAGGAAGAAGAGGAGGATGAAGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR202276 protein sequence
Red=Cloning site Green=Tags(s) MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKAR YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKD KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEEEEDEEEEEEDEE myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | BC002050 |
ORF Size | 630 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC002050, AAH02050 |
RefSeq Size | 1076 bp |
RefSeq ORF | 632 bp |
Locus ID | 97165 |
MW | 24.2 kDa |
Gene Summary | Multifunctional protein with various roles in different cellular compartments. May act in a redox sensitive manner. In the nucleus is an abundant chromatin-associated non-histone protein involved in transcription, chromatin remodeling and V(D)J recombination and probably other processes. Binds DNA with a preference to non-canonical DNA structures such as single-stranded DNA. Can bent DNA and enhance DNA flexibility by looping thus providing a mechanism to promote activities on various gene promoters by enhancing transcription factor binding and/or bringing distant regulatory sequences into close proximity (By similarity). Involved in V(D)J recombination by acting as a cofactor of the RAG complex: acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS) (PubMed:9184213). Proposed to be involved in the innate immune response to nucleic acids by acting as a cytoplasmic promiscuous immunogenic DNA/RNA sensor which cooperates with subsequent discriminative sensing by specific pattern recognition receptors (PubMed:19890330). In the extracellular compartment acts as a chemokine. Promotes proliferation and migration of endothelial cells implicating AGER/RAGE (By similarity). Has antimicrobial activity in gastrointestinal epithelial tissues (By similarity). Involved in inflammatory response to antigenic stimulus coupled with proinflammatory activity (PubMed:25306442). May play a role in germ cell differentiation (PubMed:11262228). Involved in modulation of neurogenesis probably by regulation of neural stem proliferation (PubMed:24391977). Involved in articular cartilage surface maintenance implicating LEF1 and the Wnt/beta-catenin pathway (PubMed:19805379).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Combined genomic and proteomic approaches reveal DNA binding sites and interaction partners of TBX2 in the developing lung
,L?dtke, TH;Wojahn, I;Kleppa, MJ;Schierstaedt, J;Christoffels, VM;K?nzler, P;Kispert, A;,
Respiratory research
,PubMed ID 33731112
[HMGB2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MG202276 | Hmgb2 (tGFP-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780) |
CNY 2850.00 |
|
MR202276L3 | Lenti ORF clone of Hmgb2 (Myc-DDK-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780) |
CNY 4750.00 |
|
MR202276L4 | Lenti ORF clone of Hmgb2 (mGFP-tagged) - Mouse high mobility group box 2 (cDNA clone MGC:6061 IMAGE:3489780) |
CNY 4750.00 |