Prelid1 (BC024813) Mouse Tagged ORF Clone
CAT#: MR201166
- TrueORF®
Prelid1 (Myc-DDK-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044)
ORF Plasmid: tGFP
"BC024813" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 1900.00
CNY 300.00
CNY 6840.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 2610524G07Rik; Preli |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR201166 representing BC024813
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR201166 representing BC024813
Red=Cloning site Green=Tags(s) MPRWAERLFPANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAW VSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKAK DLANKAATKQQQRQLV myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | BC024813 |
ORF Size | 97 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC024813, AAH24813 |
RefSeq Size | 899 bp |
RefSeq ORF | 470 bp |
Locus ID | 66494 |
MW | 32.9 kDa |
Gene Summary | Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Regulates the mitochondrial apoptotic pathway in primary Th cells. Regulates Th cell differentiation by down-regulating STAT6 thereby reducing IL-4-induced Th2 cell number. May be important for the development of vital and immunocompetent organs (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MG201166 | Prelid1 (tGFP-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044) |
CNY 2090.00 |
|
MR201166L3 | Lenti ORF clone of Prelid1 (Myc-DDK-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044) |
CNY 3800.00 |
|
MR201166L4 | Lenti ORF clone of Prelid1 (mGFP-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044) |
CNY 3800.00 |
其它Prelid1产品