Hbb (BC032264) Mouse Tagged ORF Clone
CAT#: MR200989
- TrueORF®
Hbb (Myc-DDK-tagged) - Mouse hemoglobin, beta adult minor chain (cDNA clone MGC:40691 IMAGE:3988455)
ORF Plasmid: tGFP
"BC032264" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 1200.00
CNY 2945.00
CNY 300.00
CNY 6840.00
Specifications
| Product Data | |
| Type | Mouse Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | AI036344; beta2; Hbb2; Hbbt2 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>MR200989 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGCACCTGACTGATGCTGAGAAGTCTGCTGTCTCTTGCCTGTGGGCAAAGGTGAACCCCGATGCAA TTGGTGGTGAGGCCCTGGGCAGGCTGCTGGTTGTCTACCCTTGGACCCAGCGGTACTTTGATAGCTTTGG AGACCTATCCTCTGCCTCTGCTATCATGGGTAATCCCAAGGTGAAGGCCCATGGCAAAAAGGTGATAACT GCCTTTAACGAGGGCCTGAAAAACCTGGACAACCTCAAGGGCACCTTTGCCAGCCTCAGTGAGCTCCACT GTGACAAGCTGCATGTGGATCCTGAGAACTTCAGGCTCCTGGGCAATGCGATCGTGATTGTGCTGGGCCA CCACCTGGGCAAGGATTTCACCCCCGCTGCACAGGCTGCCTTCCAGAAGGTGGTGGCTGGAGTGGCCACT GCCCTGGCTCACAAGTACCAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200989 protein sequence
Red=Cloning site Green=Tags(s) MVHLTDAEKSAVSCLWAKVNPDAIGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVIT AFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVAT ALAHKYH myc-FLAG tag |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | BC032264 |
| ORF Size | 441 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | BC032264, AAH32264 |
| RefSeq Size | 634 bp |
| RefSeq ORF | 443 bp |
| Locus ID | 15130 |
| MW | 15.8 kDa |
| Gene Summary | This gene encodes a beta polypeptide chain found in adult hemoglobin, which consists of a tetramer of two alpha chains and two beta chains, and which functions in the transport of oxygen to various peripheral tissues. This gene is one of a cluster of beta-hemoglobin genes that are distally regulated by a locus control region, and which are organized along the chromosome in the order of their developmental expression. In mouse, two major strain-specific haplotypes of the beta-globin gene cluster are found - a "single" haplotype found in C57BL/-type strains, which includes two highly similar adult beta-globin genes, beta s and beta t, and a "diffuse" haplotype found in strains such as BALB/c and 129Sv, which includes two somewhat diverse adult beta-globin genes, beta-major and beta-minor. This gene represents the beta-minor adult gene found in the "diffuse" haplotype. Primary chromosome 7 of the mouse reference genome assembly, which is derived from C57BL/6 strain mice, represents the "single" haplotype, while the "diffuse" haplotype is represented in the reference genome collection by the BALB/c strain alternate contig, NT_095534.1. [provided by RefSeq, May 2013] |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| MG200989 | Hbb (tGFP-tagged) - Mouse hemoglobin, beta adult minor chain (cDNA clone MGC:40691 IMAGE:3988455) |
CNY 2850.00 |
|
| MR200989L3 | Lenti ORF clone of Hbb (Myc-DDK-tagged) - Mouse hemoglobin, beta adult minor chain (cDNA clone MGC:40691 IMAGE:3988455) |
CNY 4750.00 |
|
| MR200989L4 | Lenti ORF clone of Hbb (mGFP-tagged) - Mouse hemoglobin, beta adult minor chain (cDNA clone MGC:40691 IMAGE:3988455) |
CNY 4750.00 |
