Ap2s1 (NM_198613) Mouse Tagged ORF Clone
CAT#: MR200768
- TrueORF®
Ap2s1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex 2, sigma 1 subunit (Ap2s1)
ORF Plasmid: tGFP
"NM_198613" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AI043088 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200768 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATCCGATTCATCCTTATCCAGTGGTACATGCAGTTCGATGACGACGAGAAGCAGAAGCTGATCGAGG AGGTGCACGCCGTGGTCACCGTCAGGGATGCCAAGCACACCAACTTTGTGGAGTTCCGGAACTTCAAGAT CATCTACCGACGCTACGCTGGCCTCTACTTCTGCATCTGCGTGGATGTCAACGACAACAATCTGGCCTAT CTCGAGGCCATCCACAACTTCGTAGAAGTGTTAAATGAATACTTCCACAATGTCTGTGAACTGGACCTGG TGTTCAACTTCTACAAGGTTTACACGGTGGTAGATGAGATGTTCCTGGCAGGAGAGATCCGAGAGACCAG CCAGACGAAGGTGCTGAAGCAGCTGCTGATGCTGCAGTCCCTGGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200768 protein sequence
Red=Cloning site Green=Tags(s) MIRFILIQWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAY LEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_198613 |
ORF Size | 399 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_198613.2 |
RefSeq Size | 798 bp |
RefSeq ORF | 429 bp |
Locus ID | 232910 |
UniProt ID | P62743 |
MW | 15.9 kDa |
Gene Summary | Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein transport via Transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif. May also play a role in extracellular calcium homeostasis (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
ASTN2 modulates synaptic strength by trafficking and degradation of surface proteins
,Behesti, H;Fore, T;Wu, P;Horn, Z;Leppert, M;Hull, C;Hatten, M;,
bioRxiv
,PubMed ID 30242134
[AP2S1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MG200768 | Ap2s1 (tGFP-tagged) - Mouse adaptor-related protein complex 2, sigma 1 subunit (Ap2s1) |
CNY 2,850.00 |
|
MR200768L3 | Lenti ORF clone of Ap2s1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex 2, sigma 1 subunit (Ap2s1) |
CNY 4,750.00 |
|
MR200768L4 | Lenti ORF clone of Ap2s1 (mGFP-tagged) - Mouse adaptor-related protein complex 2, sigma 1 subunit (Ap2s1) |
CNY 4,750.00 |